| UniProt ID | NDUAD_HUMAN | |
|---|---|---|
| UniProt AC | Q9P0J0 | |
| Protein Name | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 | |
| Gene Name | NDUFA13 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 144 | |
| Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein Matrix side. Nucleus . Localizes mainly in the mitochondrion (PubMed:12628925). May be translocated into the nucleus upon IFN/RA treatment. |
|
| Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. [PubMed: 27626371 Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone] | |
| Protein Sequence | MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAASKVKQD ------CCCCCCCCC | 22.05 | - | |
| 5 | Ubiquitination | ---MAASKVKQDMPP ---CCCCCCCCCCCC | 49.04 | 22817900 | |
| 7 | Ubiquitination | -MAASKVKQDMPPPG -CCCCCCCCCCCCCC | 44.30 | 21906983 | |
| 16 | Phosphorylation | DMPPPGGYGPIDYKR CCCCCCCCCCCCCCC | 26.16 | 29496907 | |
| 21 | Phosphorylation | GGYGPIDYKRNLPRR CCCCCCCCCCCCCCC | 16.74 | 29496907 | |
| 22 | Ubiquitination | GYGPIDYKRNLPRRG CCCCCCCCCCCCCCC | 30.94 | 21890473 | |
| 22 | Ubiquitination | GYGPIDYKRNLPRRG CCCCCCCCCCCCCCC | 30.94 | 27667366 | |
| 22 | Acetylation | GYGPIDYKRNLPRRG CCCCCCCCCCCCCCC | 30.94 | 26051181 | |
| 31 | Phosphorylation | NLPRRGLSGYSMLAI CCCCCCCCHHHHHHH | 38.21 | 25867546 | |
| 33 | Phosphorylation | PRRGLSGYSMLAIGI CCCCCCHHHHHHHHH | 6.37 | 25867546 | |
| 34 | Phosphorylation | RRGLSGYSMLAIGIG CCCCCHHHHHHHHHC | 15.73 | 25867546 | |
| 42 | Phosphorylation | MLAIGIGTLIYGHWS HHHHHHCHHHHCHHH | 14.20 | 25867546 | |
| 45 | Phosphorylation | IGIGTLIYGHWSIMK HHHCHHHHCHHHHHH | 13.17 | 25867546 | |
| 49 | Phosphorylation | TLIYGHWSIMKWNRE HHHHCHHHHHHHHHH | 13.71 | 25867546 | |
| 52 | Ubiquitination | YGHWSIMKWNRERRR HCHHHHHHHHHHHHC | 39.38 | 23503661 | |
| 79 | Phosphorylation | LPLLQAETDRRTLQM HHHHHHHHHHHHHHH | 37.51 | 21406692 | |
| 81 | Methylation | LLQAETDRRTLQMLR HHHHHHHHHHHHHHH | 40.69 | - | |
| 90 | Ubiquitination | TLQMLRENLEEEAII HHHHHHHCHHHHCEE | 46.44 | 21890473 | |
| 99 | Ubiquitination | EEEAIIMKDVPDWKV HHHCEEEECCCCCCC | 45.20 | 21963094 | |
| 99 | Ubiquitination | EEEAIIMKDVPDWKV HHHCEEEECCCCCCC | 45.20 | 21890473 | |
| 105 | Ubiquitination | MKDVPDWKVGESVFH EECCCCCCCCCCCCC | 47.98 | 21890473 | |
| 105 | Ubiquitination | MKDVPDWKVGESVFH EECCCCCCCCCCCCC | 47.98 | 21906983 | |
| 114 | Phosphorylation | GESVFHTTRWVPPLI CCCCCCCCCCCCCHH | 17.60 | 26437602 | |
| 125 | Phosphorylation | PPLIGELYGLRTTEE CCHHHHHHCCCCHHH | 15.15 | 29496907 | |
| 182 | Ubiquitination | --------------------------------------------- --------------------------------------------- | 21890473 | ||
| 188 | Ubiquitination | --------------------------------------------------- --------------------------------------------------- | 21890473 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUAD_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUAD_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUAD_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 607464 | Hurthle cell thyroid carcinoma (HCTC) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...