TIM23_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TIM23_HUMAN
• UniProt AC: O14925
• Protein Name: Mitochondrial import inner membrane translocase subunit Tim23
• Gene Name: TIMM23
• Organism: Homo sapiens (Human).
• Sequence Length: 209
• Subcellular Localization: Mitochondrion inner membrane ; Multi-pass membrane protein .
• Protein Description: Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane..
• Protein Sequence: MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
52	Phosphorylation	YLNVDPRYLVQDTDE CCCCCHHHEECCCCC	19.33	28152594
68	Ubiquitination	ILPTGANKTRGRFEL EECCCCCCCCCCEEE	38.78	21906983
101	Ubiquitination	NGLRLGLKETQNMAW HCCHHCCHHHHHCCC	57.84	-
103	O-linked_Glycosylation	LRLGLKETQNMAWSK CHHCCHHHHHCCCCC	24.53	30379171
110	Ubiquitination	TQNMAWSKPRNVQIL HHHCCCCCCCCHHHH	36.98	27667366
157	Phosphorylation	GAEDDLNTVAAGTMT CCCCCHHHHHHHHHH	20.86	21406692
162	Phosphorylation	LNTVAAGTMTGMLYK HHHHHHHHHHHHHHH	13.56	21406692
164	Phosphorylation	TVAAGTMTGMLYKCT HHHHHHHHHHHHHCC	21.19	21406692
168	Phosphorylation	GTMTGMLYKCTGGLR HHHHHHHHHCCCCCH	8.63	21406692
208	Phosphorylation	KGSLLQQSL------ CHHHHHHCC------	24.08	25262027

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TIM23_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TIM23_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TIM23_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GTR8_HUMAN	SLC2A8	physical	28514442
AT12A_HUMAN	ATP12A	physical	28514442
T184B_HUMAN	TMEM184B	physical	28514442
GLMP_HUMAN	C1orf85	physical	28514442
RUFY1_HUMAN	RUFY1	physical	28514442
FYV1_HUMAN	PIKFYVE	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.