UniProt ID | GLMP_HUMAN | |
---|---|---|
UniProt AC | Q8WWB7 | |
Protein Name | Glycosylated lysosomal membrane protein {ECO:0000312|HGNC:HGNC:29436} | |
Gene Name | GLMP {ECO:0000312|HGNC:HGNC:29436} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 406 | |
Subcellular Localization |
Lysosome membrane Single-pass type I membrane protein . |
|
Protein Description | ||
Protein Sequence | MRGSVECTWGWGHCAPSPLLLWTLLLFAAPFGLLGEKTRQVSLEVIPNWLGPLQNLLHIRAVGTNSTLHYVWSSLGPLAVVMVATNTPHSTLSVNWSLLLSPEPDGGLMVLPKDSIQFSSALVFTRLLEFDSTNVSDTAAKPLGRPYPPYSLADFSWNNITDSLDPATLSATFQGHPMNDPTRTFANGSLAFRVQAFSRSSRPAQPPRLLHTADTCQLEVALIGASPRGNRSLFGLEVATLGQGPDCPSMQEQHSIDDEYAPAVFQLDQLLWGSLPSGFAQWRPVAYSQKPGGRESALPCQASPLHPALAYSLPQSPIVRAFFGSQNNFCAFNLTFGASTGPGYWDQHYLSWSMLLGVGFPPVDGLSPLVLGIMAVALGAPGLMLLGGGLVLLLHHKKYSEYQSIN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 (in isoform 2) | Phosphorylation | - | 22210691 | ||
38 (in isoform 2) | Phosphorylation | - | 22210691 | ||
44 (in isoform 2) | Phosphorylation | - | 22210691 | ||
65 | N-linked_Glycosylation | HIRAVGTNSTLHYVW EEEEEECCHHHHHHH | UniProtKB CARBOHYD | ||
134 | N-linked_Glycosylation | LLEFDSTNVSDTAAK HHHCCCCCCCCCCCC | UniProtKB CARBOHYD | ||
159 | N-linked_Glycosylation | LADFSWNNITDSLDP HHHCCCCCCCCCCCH | UniProtKB CARBOHYD | ||
187 | N-linked_Glycosylation | DPTRTFANGSLAFRV CCCCEECCCCEEEEE | UniProtKB CARBOHYD | ||
200 | Phosphorylation | RVQAFSRSSRPAQPP EEEEECCCCCCCCCC | 27794612 | ||
201 | Phosphorylation | VQAFSRSSRPAQPPR EEEECCCCCCCCCCC | 24247654 | ||
226 | Phosphorylation | EVALIGASPRGNRSL EEEEECCCCCCCCEE | 28122231 | ||
230 | N-linked_Glycosylation | IGASPRGNRSLFGLE ECCCCCCCCEECCEE | UniProtKB CARBOHYD | ||
398 | Ubiquitination | VLLLHHKKYSEYQSI HHEEECCCHHHHCCC | - | ||
399 | Phosphorylation | LLLHHKKYSEYQSIN HEEECCCHHHHCCCC | 28796482 | ||
400 | Phosphorylation | LLHHKKYSEYQSIN- EEECCCHHHHCCCC- | 28796482 | ||
402 | Phosphorylation | HHKKYSEYQSIN--- ECCCHHHHCCCC--- | 28796482 | ||
404 | Phosphorylation | KKYSEYQSIN----- CCHHHHCCCC----- | 28796482 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GLMP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GLMP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GLMP_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...