| UniProt ID | AB17B_HUMAN | |
|---|---|---|
| UniProt AC | Q5VST6 | |
| Protein Name | Alpha/beta hydrolase domain-containing protein 17B {ECO:0000305} | |
| Gene Name | ABHD17B {ECO:0000312|HGNC:HGNC:24278} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 288 | |
| Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . Recycling endosome membrane Lipid-anchor Cytoplasmic side . Cell projection, dendritic spine . Cell junction, synapse, postsynaptic cell membrane, postsynaptic density . |
|
| Protein Description | Hydrolyzes fatty acids from S-acylated cysteine residues in proteins. [PubMed: 26701913 Has depalmitoylating activity towards DLG4/PSD95] | |
| Protein Sequence | MNNLSFSELCCLFCCPPCPGKIASKLAFLPPDPTYTLMCDESGSRWTLHLSERADWQYSSREKDAIECFMTRTSKGNRIACMFVRCSPNAKYTLLFSHGNAVDLGQMSSFYIGLGSRINCNIFSYDYSGYGASSGKPTEKNLYADIEAAWLALRTRYGIRPENVIIYGQSIGTVPSVDLAARYESAAVILHSPLTSGMRVAFPDTKKTYCFDAFPNIDKISKITSPVLIIHGTEDEVIDFSHGLALFERCQRPVEPLWVEGAGHNDVELYGQYLERLKQFVSQELVNL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 34 | Phosphorylation | AFLPPDPTYTLMCDE CCCCCCCCEEEEECC | 28122231 | ||
| 35 | Phosphorylation | FLPPDPTYTLMCDES CCCCCCCEEEEECCC | 28122231 | ||
| 36 | Phosphorylation | LPPDPTYTLMCDESG CCCCCCEEEEECCCC | 28122231 | ||
| 42 | Phosphorylation | YTLMCDESGSRWTLH EEEEECCCCCEEEEE | 28122231 | ||
| 44 | Phosphorylation | LMCDESGSRWTLHLS EEECCCCCEEEEEEH | 28122231 | ||
| 51 | Phosphorylation | SRWTLHLSERADWQY CEEEEEEHHCCCCCC | 24719451 | ||
| 63 | Ubiquitination | WQYSSREKDAIECFM CCCCCCCCHHHHHHE | - | ||
| 136 | Ubiquitination | GYGASSGKPTEKNLY CCCCCCCCCCCCCCH | - | ||
| 185 | Phosphorylation | DLAARYESAAVILHS HHHHHCCCEEEEEEC | - | ||
| 192 | Phosphorylation | SAAVILHSPLTSGMR CEEEEEECCCCCCCE | - | ||
| 206 | Ubiquitination | RVAFPDTKKTYCFDA EEECCCCCCEEEEEC | 2190698 | ||
| 206 (in isoform 2) | Ubiquitination | - | 21906983 | ||
| 206 (in isoform 1) | Ubiquitination | - | 21906983 | ||
| 207 | Ubiquitination | VAFPDTKKTYCFDAF EECCCCCCEEEEECC | - | ||
| 210 | S-palmitoylation | PDTKKTYCFDAFPNI CCCCCEEEEECCCCH | 29575903 | ||
| 219 | Ubiquitination | DAFPNIDKISKITSP ECCCCHHHHHCCCCC | - | ||
| 222 | Ubiquitination | PNIDKISKITSPVLI CCHHHHHCCCCCEEE | - | ||
| 278 | Ubiquitination | GQYLERLKQFVSQEL HHHHHHHHHHHHHHH | - | ||
| 282 | Phosphorylation | ERLKQFVSQELVNL- HHHHHHHHHHHHCC- | 29507054 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AB17B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AB17B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AB17B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of AB17B_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
