dbPTM

ORNT1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ORNT1_HUMAN
UniProt AC	Q9Y619
Protein Name	Mitochondrial ornithine transporter 1
Gene Name	SLC25A15
Organism	Homo sapiens (Human).
Sequence Length	301
Subcellular Localization	Mitochondrion inner membrane Multi-pass membrane protein .
Protein Description	Ornithine-citrulline antiporter. Connects the cytosolic and the intramitochondrial reactions of the urea cycle by exchanging cytosolic ornithine with matrix citrulline. [PubMed: 12807890 The stoichiometry is close to 1:1 (By similarity]
Protein Sequence	MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQVLSMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEAY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
36	Malonylation	PFDTMKVKMQTFPDL CCCCCEEEECCCHHH	21.55	26320211
100	Ubiquitination	RKVAGLDKQAKLSDL HHHCCCCHHHCHHHH	58.14	29967540
142	Phosphorylation	QTMYEMETSGKIAKS HHHHHHHCCCCCCCC	41.28	20860994
145	Phosphoglycerylation	YEMETSGKIAKSQNT HHHHCCCCCCCCHHH	38.98	-
152	Phosphorylation	KIAKSQNTVWSVIKS CCCCCHHHHHHHHHH	18.73	-
159	Phosphorylation	TVWSVIKSILRKDGP HHHHHHHHHHHHCCC	18.74	24719451
196	Phosphorylation	GGYELSRSFFASGRS CCCEEEHHHHHCCCC	22.72	27499020
245	Ubiquitination	QVLSMSGKQAGFIRT HHHHCCCCCCCCCHH	29.66	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ORNT1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ORNT1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ORNT1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
ZG16B_HUMAN	ZG16B	physical	26186194
IGJ_HUMAN	IGJ	physical	28514442

Drug and Disease Associations

Kegg Disease
H01268	Hyperornithinemia-hyperammonemia-homocitrullinuria syndrome; HHH syndrome
OMIM Disease
238970	Hyperornithinemia-hyperammonemia-homocitrullinuria syndrome (HHH syndrome)
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
DB00129	L-Ornithine

Regulatory Network of ORNT1_HUMAN

Related Literatures of Post-Translational Modification