| UniProt ID | ZG16B_HUMAN | |
|---|---|---|
| UniProt AC | Q96DA0 | |
| Protein Name | Zymogen granule protein 16 homolog B | |
| Gene Name | ZG16B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 208 | |
| Subcellular Localization | Secreted . | |
| Protein Description | ||
| Protein Sequence | MGAQGAQESIKAMWRVPGTTRRPVTGESPGMHRPEAMLLLLTLALLGGPTWAGKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 70 | Phosphorylation | YFSTTEDYDHEITGL CEECCCCCCCCCCCC | 16.99 | - | |
| 75 | Phosphorylation | EDYDHEITGLRVSVG CCCCCCCCCCEEEEE | 27.46 | 24719451 | |
| 136 | Phosphorylation | FLRGMVMYTSKDRYF HHCCCCEEECCCCEE | 9.10 | 28348404 | |
| 137 | Phosphorylation | LRGMVMYTSKDRYFY HCCCCEEECCCCEEE | 15.94 | 28348404 | |
| 144 | Phosphorylation | TSKDRYFYFGKLDGQ ECCCCEEEEEEECCE | 11.50 | 22817900 | |
| 197 | N-linked_Glycosylation | PTTEPPVNLTYSANS CCCCCCCCCEEECCC | 32.22 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZG16B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZG16B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZG16B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GOGA2_HUMAN | GOLGA2 | physical | 21516116 | |
| ZN423_HUMAN | ZNF423 | physical | 28514442 | |
| SARM1_HUMAN | SARM1 | physical | 28514442 | |
| DDI2_HUMAN | DDI2 | physical | 28514442 | |
| RSCA1_HUMAN | RSC1A1 | physical | 28514442 | |
| ITIH2_HUMAN | ITIH2 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
