UniProt ID | ZG16B_HUMAN | |
---|---|---|
UniProt AC | Q96DA0 | |
Protein Name | Zymogen granule protein 16 homolog B | |
Gene Name | ZG16B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 208 | |
Subcellular Localization | Secreted . | |
Protein Description | ||
Protein Sequence | MGAQGAQESIKAMWRVPGTTRRPVTGESPGMHRPEAMLLLLTLALLGGPTWAGKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
70 | Phosphorylation | YFSTTEDYDHEITGL CEECCCCCCCCCCCC | 16.99 | - | |
75 | Phosphorylation | EDYDHEITGLRVSVG CCCCCCCCCCEEEEE | 27.46 | 24719451 | |
136 | Phosphorylation | FLRGMVMYTSKDRYF HHCCCCEEECCCCEE | 9.10 | 28348404 | |
137 | Phosphorylation | LRGMVMYTSKDRYFY HCCCCEEECCCCEEE | 15.94 | 28348404 | |
144 | Phosphorylation | TSKDRYFYFGKLDGQ ECCCCEEEEEEECCE | 11.50 | 22817900 | |
197 | N-linked_Glycosylation | PTTEPPVNLTYSANS CCCCCCCCCEEECCC | 32.22 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZG16B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZG16B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZG16B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GOGA2_HUMAN | GOLGA2 | physical | 21516116 | |
ZN423_HUMAN | ZNF423 | physical | 28514442 | |
SARM1_HUMAN | SARM1 | physical | 28514442 | |
DDI2_HUMAN | DDI2 | physical | 28514442 | |
RSCA1_HUMAN | RSC1A1 | physical | 28514442 | |
ITIH2_HUMAN | ITIH2 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...