UniProt ID | MTG2_HUMAN | |
---|---|---|
UniProt AC | Q9H4K7 | |
Protein Name | Mitochondrial ribosome-associated GTPase 2 | |
Gene Name | MTG2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 406 | |
Subcellular Localization |
Mitochondrion. Mitochondrion inner membrane Peripheral membrane protein Matrix side. |
|
Protein Description | Plays a role in the regulation of the mitochondrial ribosome assembly and of translational activity. Displays GTPase activity. Involved in the ribosome maturation process.. | |
Protein Sequence | MAPARCFSARLRTVFQGVGHWALSTWAGLKPSRLLPQRASPRLLSVGRADLAKHQELPGKKLLSEKKLKRYFVDYRRVLVCGGNGGAGASCFHSEPRKEFGGPDGGDGGNGGHVILRVDQQVKSLSSVLSRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPVTCTPGQPGQQRVLHLELKTVAHAGMVGFPNAGKSSLLRAISNARPAVASYPFTTLKPHVGIVHYEGHLQIAVADIPGIIRGAHQNRGLGSAFLRHIERCRFLLFVVDLSQPEPWTQVDDLKYELEMYEKGLSARPHAIVANKIDLPEAQANLSQLRDHLGQEVIVLSALTGENLEQLLLHLKVLYDAYAEAELGQGRQPLRW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
40 | Phosphorylation | RLLPQRASPRLLSVG HCCCCCCCCCCEEEC | 32645325 | ||
64 | Phosphorylation | LPGKKLLSEKKLKRY CCCCCCCCHHHHHHH | 24719451 | ||
71 | Phosphorylation | SEKKLKRYFVDYRRV CHHHHHHHCCCCCEE | 26074081 | ||
75 | Phosphorylation | LKRYFVDYRRVLVCG HHHHCCCCCEEEEEC | 26074081 | ||
123 | Ubiquitination | LRVDQQVKSLSSVLS EEEHHHHHHHHHHHH | 21890473 | ||
123 | Ubiquitination | LRVDQQVKSLSSVLS EEEHHHHHHHHHHHH | 21890473 | ||
124 | Phosphorylation | RVDQQVKSLSSVLSR EEHHHHHHHHHHHHH | 17322306 | ||
130 | Phosphorylation | KSLSSVLSRYQGFSG HHHHHHHHHHCCCCC | 17322306 | ||
132 | Phosphorylation | LSSVLSRYQGFSGED HHHHHHHHCCCCCCC | 23312004 | ||
136 | Phosphorylation | LSRYQGFSGEDGGSK HHHHCCCCCCCCCCC | 23312004 | ||
139 | Ubiquitination | YQGFSGEDGGSKNCF HCCCCCCCCCCCCCC | 21890473 | ||
142 | Phosphorylation | FSGEDGGSKNCFGRS CCCCCCCCCCCCCCC | 23312004 | ||
151 | Ubiquitination | NCFGRSGAVLYIRVP CCCCCCCCEEEEEEE | 21890473 | ||
239 | Phosphorylation | FPNAGKSSLLRAISN CCCCCHHHHHHHHHC | 24719451 | ||
357 | Phosphorylation | PEAQANLSQLRDHLG HHHHHHHHHHHHHHC | - | ||
389 | Phosphorylation | LLHLKVLYDAYAEAE HHHHHHHHHHHHHHH | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MTG2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MTG2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MTG2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PPCE_HUMAN | PREP | physical | 28514442 | |
CH60_HUMAN | HSPD1 | physical | 28514442 | |
CLPP_HUMAN | CLPP | physical | 28514442 | |
IF2M_HUMAN | MTIF2 | physical | 28514442 | |
MPPA_HUMAN | PMPCA | physical | 28514442 | |
SIR3_HUMAN | SIRT3 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...