UniProt ID | MCAT_HUMAN | |
---|---|---|
UniProt AC | O43772 | |
Protein Name | Mitochondrial carnitine/acylcarnitine carrier protein | |
Gene Name | SLC25A20 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 301 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein. |
|
Protein Description | Mediates the transport of acylcarnitines of different length across the mitochondrial inner membrane from the cytosol to the mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway.. | |
Protein Sequence | MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPNL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MADQPKPIS ------CCCCCCCCC | 24.93 | 25944712 | |
9 | Phosphorylation | ADQPKPISPLKNLLA CCCCCCCCHHHHHHC | 32.48 | 29255136 | |
124 | Phosphorylation | GMLSGVFTTGIMTPG HHHCCCEECCCCCCH | 23.00 | - | |
143 | Phosphorylation | CLLQIQASSGESKYT EEEEEEECCCCCCCE | 23.62 | 25072903 | |
144 | Phosphorylation | LLQIQASSGESKYTG EEEEEECCCCCCCEE | 49.98 | 25072903 | |
147 | Phosphorylation | IQASSGESKYTGTLD EEECCCCCCCEEEHH | 34.19 | 25072903 | |
148 | Acetylation | QASSGESKYTGTLDC EECCCCCCCEEEHHH | 42.39 | - | |
157 | Acetylation | TGTLDCAKKLYQEFG EEEHHHHHHHHHHHC | 50.03 | - | |
157 | Ubiquitination | TGTLDCAKKLYQEFG EEEHHHHHHHHHHHC | 50.03 | - | |
166 | Methylation | LYQEFGIRGIYKGTV HHHHHCCCCEEECCE | 26.32 | 115917069 | |
169 | Phosphorylation | EFGIRGIYKGTVLTL HHCCCCEEECCEEEE | 13.24 | - | |
170 | Acetylation | FGIRGIYKGTVLTLM HCCCCEEECCEEEEE | 46.30 | - | |
170 | Succinylation | FGIRGIYKGTVLTLM HCCCCEEECCEEEEE | 46.30 | - | |
170 | Succinylation | FGIRGIYKGTVLTLM HCCCCEEECCEEEEE | 46.30 | - | |
183 | Phosphorylation | LMRDVPASGMYFMTY EEECCCCCCEEEEEH | 20.30 | 27251275 | |
186 | Phosphorylation | DVPASGMYFMTYEWL CCCCCCEEEEEHHHH | 8.17 | 27251275 | |
189 | Phosphorylation | ASGMYFMTYEWLKNI CCCEEEEEHHHHHHH | 14.37 | 27251275 | |
190 | Phosphorylation | SGMYFMTYEWLKNIF CCEEEEEHHHHHHHC | 8.04 | 27251275 | |
198 | Phosphorylation | EWLKNIFTPEGKRVS HHHHHHCCCCCCCHH | 19.34 | 27251275 | |
205 | Phosphorylation | TPEGKRVSELSAPRI CCCCCCHHHCCCCEE | 36.53 | 20833797 | |
208 | Phosphorylation | GKRVSELSAPRILVA CCCHHHCCCCEEEEE | 31.98 | 24719451 | |
244 | Ubiquitination | FQTAPPGKYPNGFRD HCCCCCCCCCCCHHH | 64.41 | 22817900 | |
244 | Acetylation | FQTAPPGKYPNGFRD HCCCCCCCCCCCHHH | 64.41 | 25038526 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MCAT_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MCAT_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MCAT_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ESR1_HUMAN | ESR1 | physical | 23178685 |
loading...