| UniProt ID | PEX16_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y5Y5 | |
| Protein Name | Peroxisomal membrane protein PEX16 | |
| Gene Name | PEX16 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 336 | |
| Subcellular Localization |
Peroxisome membrane Multi-pass membrane protein . Endoplasmic reticulum membrane . |
|
| Protein Description | Required for peroxisome membrane biogenesis. May play a role in early stages of peroxisome assembly. Can recruit other peroxisomal proteins, such as PEX3 and PMP34, to de novo peroxisomes derived from the endoplasmic reticulum (ER). May function as receptor for PEX3.. | |
| Protein Sequence | MEKLRLLGLRYQEYVTRHPAATAQLETAVRGFSYLLAGRFADSHELSELVYSASNLLVLLNDGILRKELRKKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALVQLAKAVLRMLLLLWFKAGLQTSPPIVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQNTPSLHSRHWGAPQQREGRQQQHHEELSATPTPLGLQETIAEFLYIARPLLHLLSLGLWGQRSWKPWLLAGVVDVTSLSLLSDRKGLTRRERRELRRRTILLLYYLLRSPFYDRFSEARILFLLQLLADHVPGVGLVTRPLMDYLPTWQKIYFYSWG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 71 | Ubiquitination | ILRKELRKKLPVSLS HHHHHHHHHCCCCHH | 71.88 | 29967540 | |
| 72 | Ubiquitination | LRKELRKKLPVSLSQ HHHHHHHHCCCCHHH | 52.14 | 29967540 | |
| 138 | Phosphorylation | FKAGLQTSPPIVPLD HHHCCCCCCCCCCCC | 18.73 | 25159151 | |
| 148 | Phosphorylation | IVPLDRETQAQPPDG CCCCCCCCCCCCCCC | 30.05 | 28450419 | |
| 158 | Phosphorylation | QPPDGDHSPGNHEQS CCCCCCCCCCCCCCC | 38.96 | 30266825 | |
| 165 | Phosphorylation | SPGNHEQSYVGKRSN CCCCCCCCCCCCCCC | 20.85 | 30108239 | |
| 166 | Phosphorylation | PGNHEQSYVGKRSNR CCCCCCCCCCCCCCH | 16.96 | 30108239 | |
| 169 | Methylation | HEQSYVGKRSNRVVR CCCCCCCCCCCHHHH | 42.48 | 115974811 | |
| 177 | Phosphorylation | RSNRVVRTLQNTPSL CCCHHHHHHCCCCCH | 22.53 | 27080861 | |
| 181 | Phosphorylation | VVRTLQNTPSLHSRH HHHHHCCCCCHHHCC | 10.99 | 28450419 | |
| 183 | Phosphorylation | RTLQNTPSLHSRHWG HHHCCCCCHHHCCCC | 36.35 | 23401153 | |
| 186 | Phosphorylation | QNTPSLHSRHWGAPQ CCCCCHHHCCCCCCC | 31.00 | 28450419 | |
| 278 | Phosphorylation | RRELRRRTILLLYYL HHHHHHHHHHHHHHH | 17.73 | - | |
| 283 | Phosphorylation | RRTILLLYYLLRSPF HHHHHHHHHHHHCCC | 7.64 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PEX16_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PEX16_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PEX16_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PEX19_HUMAN | PEX19 | physical | 11390669 | |
| PEX19_HUMAN | PEX19 | physical | 12096124 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| H00205 | Zellweger syndrome spectrum, including: Zellweger syndrome (ZS); Adrenoleukodystrophy, neonatal (NAL | |||||
| OMIM Disease | ||||||
| 614876 | Peroxisome biogenesis disorder complementation group 9 (PBD-CG9) | |||||
| 614876 | Peroxisome biogenesis disorder 8A (PBD8A) | |||||
| 614877 | Peroxisome biogenesis disorder 8B (PBD8B) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
