GTR8_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GTR8_HUMAN
• UniProt AC: Q9NY64
• Protein Name: Solute carrier family 2, facilitated glucose transporter member 8
• Gene Name: SLC2A8
• Organism: Homo sapiens (Human).
• Sequence Length: 477
• Subcellular Localization: Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Principally intracellular. May move between intracellular vesicles and the plasma membrane. The dileucine internalization motif is critical for int
• Protein Description: Insulin-regulated facilitative glucose transporter. Binds cytochalasin B in a glucose-inhibitable manner. Seems to be a dual-specific sugar transporter as it is inhibitable by fructose (By similarity)..
• Protein Sequence: MTPEDPEETQPLLGPPGGSAPRGRRVFLAAFAAALGPLSFGFALGYSSPAIPSLQRAAPPAPRLDDAAASWFGAVVTLGAAAGGVLGGWLVDRAGRKLSLLLCSVPFVAGFAVITAAQDVWMLLGGRLLTGLACGVASLVAPVYISEIAYPAVRGLLGSCVQLMVVVGILLAYLAGWVLEWRWLAVLGCVPPSLMLLLMCFMPETPRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAEQSFHLALLRQPGIYKPFIIGVSLMAFQQLSGVNAVMFYAETIFEEAKFKDSSLASVVVGVIQVLFTAVAALIMDRAGRRLLLVLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPVDASVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWLMAFLVTKEFSSLMEVLRPYGAFWLASAFCIFSVLFTLFCVPETKGKTLEQITAHFEGR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
53	Phosphorylation	YSSPAIPSLQRAAPP CCCCCCHHHHHHCCC	30.90	26091039
349	N-linked_Glycosylation	LTQGGPGNSSHVAIS ECCCCCCCCCEEEEE	43.40	UniProtKB CARBOHYD
465	Ubiquitination	CVPETKGKTLEQITA CCCCCCCCCHHHHHH	52.04	21890473
465	Ubiquitination	CVPETKGKTLEQITA CCCCCCCCCHHHHHH	52.04	21890473

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GTR8_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GTR8_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GTR8_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AP1B1_HUMAN	AP1B1	physical	16723738
AP2B1_HUMAN	AP2B1	physical	16723738
AP2A2_HUMAN	AP2A2	physical	16723738

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.