dbPTM

NDUA3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NDUA3_HUMAN
UniProt AC	O95167
Protein Name	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3
Gene Name	NDUFA3
Organism	Homo sapiens (Human).
Sequence Length	84
Subcellular Localization	Mitochondrion inner membrane Single-pass membrane protein .
Protein Description	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone..
Protein Sequence	MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAARVGAFL ------CCHHHHHHH	12.18	-
36	Phosphorylation	AVILPPLSPYFKYSV EEECCCCCCCEEEEE	24.27	-
41	Phosphorylation	PLSPYFKYSVMINKA CCCCCEEEEEEEECC	9.15	20833797
42	Phosphorylation	LSPYFKYSVMINKAT CCCCEEEEEEEECCC	13.05	22673903
47	Ubiquitination	KYSVMINKATPYNYP EEEEEEECCCCCCCC	42.59	2189047
82	Ubiquitination	GPSLEWLKKL----- CCCHHHHHCC-----	53.77	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NDUA3_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NDUA3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NDUA3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
ZMY10_HUMAN	ZMYND10	physical	27173435

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NDUA3_HUMAN

Related Literatures of Post-Translational Modification