UniProt ID | NDUA3_HUMAN | |
---|---|---|
UniProt AC | O95167 | |
Protein Name | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 | |
Gene Name | NDUFA3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 84 | |
Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein . |
|
Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.. | |
Protein Sequence | MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAARVGAFL ------CCHHHHHHH | 12.18 | - | |
36 | Phosphorylation | AVILPPLSPYFKYSV EEECCCCCCCEEEEE | 24.27 | - | |
41 | Phosphorylation | PLSPYFKYSVMINKA CCCCCEEEEEEEECC | 9.15 | 20833797 | |
42 | Phosphorylation | LSPYFKYSVMINKAT CCCCEEEEEEEECCC | 13.05 | 22673903 | |
47 | Ubiquitination | KYSVMINKATPYNYP EEEEEEECCCCCCCC | 42.59 | 2189047 | |
82 | Ubiquitination | GPSLEWLKKL----- CCCHHHHHCC----- | 53.77 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUA3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUA3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUA3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ZMY10_HUMAN | ZMYND10 | physical | 27173435 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...