ZMY10_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ZMY10_HUMAN
• UniProt AC: O75800
• Protein Name: Zinc finger MYND domain-containing protein 10
• Gene Name: ZMYND10
• Organism: Homo sapiens (Human).
• Sequence Length: 440
• Subcellular Localization: Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriolar satellite. Localizes to sites proximal to the axoneme..
• Protein Description: Required for motile ciliary function. Probably involved in axonemal assembly of inner and outer dynein arms (IDA and ODA, respectively) for proper axoneme building for cilia motility. May act by indirectly regulating transcription of dynein proteins..
• Protein Sequence: MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQELLVTHGKVPTLVEELIAVEMWKQKVFPVFCRVEDFKPQNTFPIYMVVHHEASIINLLETVFFHKEVCESAEDTVLDLVDYCHRKLTLLVAQSGCGGPPEGEGSQDSNPMQELQKQAELMEFEIALKALSVLRYITDCVDSLSLSTLSRMLSTHNLPCLLVELLEHSPWSRREGGKLQQFEGSRWHTVAPSEQQKLSKLDGQVWIALYNLLLSPEAQARYCLTSFAKGRLLKLRAFLTDTLLDQLPNLAHLQSFLAHLTLTETQPPKKDLVLEQIPEIWERLERENRGKWQAIAKHQLQHVFSPSEQDLRLQARRWAETYRLDVLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQVKHWEKHGKTCVLAAQGDRAK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
189	Phosphorylation	EIALKALSVLRYITD HHHHHHHHHHHHHHH	24.78	24719451
254	Ubiquitination	VAPSEQQKLSKLDGQ CCCHHHHHHHHCCHH	55.19	-
283	Phosphorylation	QARYCLTSFAKGRLL HHHHHHHHHHHCHHH	15.40	24719451
327	Ubiquitination	TETQPPKKDLVLEQI CCCCCCCCCCHHHHH	63.17	29967540
348	Ubiquitination	LERENRGKWQAIAKH HHHHCCCHHHHHHHH	32.66	29967540
364	Phosphorylation	LQHVFSPSEQDLRLQ HHHCCCCCHHHHHHH	46.84	25693802

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ZMY10_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ZMY10_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ZMY10_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
T22D4_HUMAN	TSC22D4	physical	16189514
T22D4_HUMAN	TSC22D4	physical	25416956
IFT43_HUMAN	IFT43	physical	25416956
NUTM1_HUMAN	NUTM1	physical	25416956
KR103_HUMAN	KRTAP10-3	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.