| UniProt ID | UQCC1_HUMAN | |
|---|---|---|
| UniProt AC | Q9NVA1 | |
| Protein Name | Ubiquinol-cytochrome-c reductase complex assembly factor 1 | |
| Gene Name | UQCC1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 299 | |
| Subcellular Localization | Mitochondrion inner membrane . Cytoplasmic vesicle. Cytoplasmic vesicular structures.. | |
| Protein Description | Required for the assembly of the ubiquinol-cytochrome c reductase complex (mitochondrial respiratory chain complex III or cytochrome b-c1 complex). Involved in cytochrome b translation and/or stability.. | |
| Protein Sequence | MALLVRVLRNQTSISQWVPVCSRLIPVSPTQGQGDRALSRTSQWPQMSQSRACGGSEQIPGIDIQLNRKYHTTRKLSTTKDSPQPVEEKVGAFTKIIEAMGFTGPLKYSKWKIKIAALRMYTSCVEKTDFEEFFLRCQMPDTFNSWFLITLLHVWMCLVRMKQEGRSGKYMCRIIVHFMWEDVQQRGRVMGVNPYILKKNMILMTNHFYAAILGYDEGILSDDHGLAAALWRTFFNRKCEDPRHLELLVEYVRKQIQYLDSMNGEDLLLTGEVSWRPLVEKNPQSILKPHSPTYNDEGL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 (in isoform 3) | Phosphorylation | - | 24043423 | ||
| 9 (in isoform 3) | Phosphorylation | - | 24043423 | ||
| 10 (in isoform 3) | Phosphorylation | - | 24043423 | ||
| 28 | Phosphorylation | CSRLIPVSPTQGQGD CCCEEECCCCCCCCH | 27282143 | ||
| 56 | Phosphorylation | QSRACGGSEQIPGID CCCCCCCCCCCCCCE | 29083192 | ||
| 70 | Phosphorylation | DIQLNRKYHTTRKLS EEEECCEECCCCCCC | 29083192 | ||
| 72 | Phosphorylation | QLNRKYHTTRKLSTT EECCEECCCCCCCCC | 29083192 | ||
| 73 | Phosphorylation | LNRKYHTTRKLSTTK ECCEECCCCCCCCCC | 29083192 | ||
| 82 | Phosphorylation | KLSTTKDSPQPVEEK CCCCCCCCCCCHHHH | 26471730 | ||
| 209 | Phosphorylation | ILMTNHFYAAILGYD EEEECCHHHHHHCCC | 18083107 | ||
| 285 | Phosphorylation | LVEKNPQSILKPHSP CCCCCCCCCCCCCCC | 24719451 | ||
| 288 | Acetylation | KNPQSILKPHSPTYN CCCCCCCCCCCCCCC | 23954790 | ||
| 288 | Ubiquitination | KNPQSILKPHSPTYN CCCCCCCCCCCCCCC | - | ||
| 288 | Malonylation | KNPQSILKPHSPTYN CCCCCCCCCCCCCCC | 26320211 | ||
| 291 | Phosphorylation | QSILKPHSPTYNDEG CCCCCCCCCCCCCCC | 25159151 | ||
| 293 | Phosphorylation | ILKPHSPTYNDEGL- CCCCCCCCCCCCCC- | 23186163 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UQCC1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UQCC1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UQCC1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| BRCA2_HUMAN | BRCA2 | physical | 19578754 | |
| UQCC2_HUMAN | UQCC2 | physical | 24385928 | |
| UQCC2_HUMAN | UQCC2 | physical | 28514442 | |
| SYYM_HUMAN | YARS2 | physical | 28514442 | |
| CLPP_HUMAN | CLPP | physical | 28514442 | |
| CDR2_HUMAN | CDR2 | physical | 27173435 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
