UniProt ID | UQCC2_HUMAN | |
---|---|---|
UniProt AC | Q9BRT2 | |
Protein Name | Ubiquinol-cytochrome-c reductase complex assembly factor 2 | |
Gene Name | UQCC2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 126 | |
Subcellular Localization | Mitochondrion matrix, mitochondrion nucleoid. Mitochondrion. Mitochondrion intermembrane space. Mitochondrion matrix. Mitochondrion inner membrane. Predominantly expressed in the mitochondrial inner membrane.. | |
Protein Description | Required for the assembly of the ubiquinol-cytochrome c reductase complex (mitochondrial respiratory chain complex III or cytochrome b-c1 complex). Plays a role in the modulation of respiratory chain activities such as oxygen consumption and ATP production and via its modulation of the respiratory chain activity can regulate skeletal muscle differentiation and insulin secretion by pancreatic beta-cells. Involved in cytochrome b translation and/or stability.. | |
Protein Sequence | MAASRYRRFLKLCEEWPVDETKRGRDLGAYLRQRVAQAFREGENTQVAEPEACDQMYESLARLHSNYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Acetylation | SRYRRFLKLCEEWPV HHHHHHHHHHHHCCC | 26822725 | ||
45 | Phosphorylation | AFREGENTQVAEPEA HHHHCCCCCCCCHHH | 29978859 | ||
53 | S-palmitoylation | QVAEPEACDQMYESL CCCCHHHHHHHHHHH | 19801377 | ||
57 | Phosphorylation | PEACDQMYESLARLH HHHHHHHHHHHHHHH | 29978859 | ||
59 | Phosphorylation | ACDQMYESLARLHSN HHHHHHHHHHHHHHC | 29978859 | ||
67 | Phosphorylation | LARLHSNYYKHKYPR HHHHHHCHHCCCCCC | - | ||
72 | Phosphorylation | SNYYKHKYPRPRDTS HCHHCCCCCCCCCCC | - | ||
79 | Phosphorylation | YPRPRDTSFSGLSLE CCCCCCCCCCCCCHH | 23532336 | ||
84 | Phosphorylation | DTSFSGLSLEEYKLI CCCCCCCCHHHHHHH | 23532336 | ||
88 | Phosphorylation | SGLSLEEYKLILSTD CCCCHHHHHHHHCCC | - | ||
93 | Phosphorylation | EEYKLILSTDTLEEL HHHHHHHCCCCHHHH | 28348404 | ||
94 | Phosphorylation | EYKLILSTDTLEELK HHHHHHCCCCHHHHH | 28348404 | ||
96 | Phosphorylation | KLILSTDTLEELKEI HHHHCCCCHHHHHHH | 28348404 | ||
101 | Ubiquitination | TDTLEELKEIDKGMW CCCHHHHHHHCHHHH | 29967540 | ||
101 | Acetylation | TDTLEELKEIDKGMW CCCHHHHHHHCHHHH | 26822725 | ||
114 | Acetylation | MWKKLQEKFAPKGPE HHHHHHHHHCCCCCH | 27452117 | ||
118 | Acetylation | LQEKFAPKGPEEDHK HHHHHCCCCCHHHCC | 11789997 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UQCC2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UQCC2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UQCC2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CEAM5_HUMAN | CEACAM5 | physical | 21988832 | |
UQCC1_HUMAN | UQCC1 | physical | 24385928 | |
CDR2_HUMAN | CDR2 | physical | 27173435 | |
URFB1_HUMAN | UHRF1BP1 | physical | 27173435 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...