UniProt ID | NDUC2_HUMAN | |
---|---|---|
UniProt AC | O95298 | |
Protein Name | NADH dehydrogenase [ubiquinone] 1 subunit C2 | |
Gene Name | NDUFC2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 119 | |
Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein Matrix side . |
|
Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.. | |
Protein Sequence | MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Phosphorylation | FLPDEARSLPPPKLT CCCHHHHCCCCCCCC | 52.88 | 24888630 | |
54 | Phosphorylation | IRRRPIATAGLHRQL HHHCCCCHHHHHHHH | 23.21 | - | |
80 | Phosphorylation | YLVKREDYLYAVRDR HECCHHHHEEEEECH | 9.25 | - | |
91 | Ubiquitination | VRDREMFGYMKLHPE EECHHHHCCCCCCHH | 21.95 | 19608861 | |
91 | Acetylation | VRDREMFGYMKLHPE EECHHHHCCCCCCHH | 21.95 | 19608861 | |
92 | Phosphorylation | RDREMFGYMKLHPED ECHHHHCCCCCCHHH | 4.64 | 29496907 | |
94 | Ubiquitination | REMFGYMKLHPEDFP HHHHCCCCCCHHHCC | 34.85 | 21890473 | |
105 | Ubiquitination | EDFPEEDKKTYGEIF HHCCHHHHHCHHHHH | 50.74 | 21890473 | |
105 | 2-Hydroxyisobutyrylation | EDFPEEDKKTYGEIF HHCCHHHHHCHHHHH | 50.74 | - | |
106 | Ubiquitination | DFPEEDKKTYGEIFE HCCHHHHHCHHHHHH | 60.34 | 21890473 | |
106 | Ubiquitination | DFPEEDKKTYGEIFE HCCHHHHHCHHHHHH | 60.34 | 21890473 | |
107 | Phosphorylation | FPEEDKKTYGEIFEK CCHHHHHCHHHHHHH | 42.36 | 29496907 | |
108 | Phosphorylation | PEEDKKTYGEIFEKF CHHHHHCHHHHHHHH | 22.95 | 29496907 | |
114 | 2-Hydroxyisobutyrylation | TYGEIFEKFHPIR-- CHHHHHHHHCCCC-- | 37.92 | - | |
114 | Malonylation | TYGEIFEKFHPIR-- CHHHHHHHHCCCC-- | 37.92 | 26320211 | |
114 | Sumoylation | TYGEIFEKFHPIR-- CHHHHHHHHCCCC-- | 37.92 | 19608861 | |
114 | Ubiquitination | TYGEIFEKFHPIR-- CHHHHHHHHCCCC-- | 37.92 | 21890473 | |
114 | Acetylation | TYGEIFEKFHPIR-- CHHHHHHHHCCCC-- | 37.92 | 25825284 | |
114 | Ubiquitination | TYGEIFEKFHPIR-- CHHHHHHHHCCCC-- | 37.92 | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUC2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUC2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUC2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NDUC2_HUMAN !! |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB01136 | Carvedilol |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-114, AND MASS SPECTROMETRY. |