| UniProt ID | TIDC1_HUMAN | |
|---|---|---|
| UniProt AC | Q9NPL8 | |
| Protein Name | Complex I assembly factor TIMMDC1, mitochondrial | |
| Gene Name | TIMMDC1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 285 | |
| Subcellular Localization |
Mitochondrion membrane Multi-pass membrane protein . |
|
| Protein Description | Chaperone protein involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Participates in constructing the membrane arm of complex I.. | |
| Protein Sequence | MEVPPPAPRSFLCRALCLFPRVFAAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRELFGKDEQQRISKDLANICKTAATAGIIGWVYGGIPAFIHAKQQYIEQSQAEIYHNRFDAVQSAHRAATRGFIRYGWRWGWRTAVFVTIFNTVNTSLNVYRNKDALSHFVIAGAVTGSLFRINVGLRGLVAGGIIGALLGTPVGGLLMAFQKYSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDKD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Phosphorylation | VPPPAPRSFLCRALC CCCCCCHHHHHHHHH | 22.85 | 24719451 | |
| 71 | Phosphorylation | KDEQQRISKDLANIC HHHHHHHHHHHHHHH | 23.47 | 25599653 | |
| 113 | Phosphorylation | EQSQAEIYHNRFDAV HHHHHHHHHCCHHHH | 5.64 | 28064214 | |
| 128 | Phosphorylation | QSAHRAATRGFIRYG HHHHHHHHHCHHHCC | 30.27 | 21712546 | |
| 166 | Phosphorylation | YRNKDALSHFVIAGA CCCCCCHHHHHHHHH | 19.32 | 27251275 | |
| 175 | Phosphorylation | FVIAGAVTGSLFRIN HHHHHHHHCHHHHCC | 22.10 | 27251275 | |
| 177 | Phosphorylation | IAGAVTGSLFRINVG HHHHHHCHHHHCCCC | 18.24 | 27251275 | |
| 232 | Ubiquitination | RKALHELKLEEWKGR HHHHHHHCHHHHCCC | 51.36 | - | |
| 237 | Ubiquitination | ELKLEEWKGRLQVTE HHCHHHHCCCCHHHH | 37.12 | - | |
| 252 | Phosphorylation | HLPEKIESSLQEDEP HCHHHHHHHHCCCCC | 39.56 | 25850435 | |
| 253 | Phosphorylation | LPEKIESSLQEDEPE CHHHHHHHHCCCCCC | 22.68 | 28355574 | |
| 264 | Ubiquitination | DEPENDAKKIEALLN CCCCCHHHHHHHHHC | 58.09 | - | |
| 277 | Phosphorylation | LNLPRNPSVIDKQDK HCCCCCHHHCCCCCC | 34.94 | 19664994 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIDC1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIDC1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIDC1_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
