UniProt ID | TIDC1_HUMAN | |
---|---|---|
UniProt AC | Q9NPL8 | |
Protein Name | Complex I assembly factor TIMMDC1, mitochondrial | |
Gene Name | TIMMDC1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 285 | |
Subcellular Localization |
Mitochondrion membrane Multi-pass membrane protein . |
|
Protein Description | Chaperone protein involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Participates in constructing the membrane arm of complex I.. | |
Protein Sequence | MEVPPPAPRSFLCRALCLFPRVFAAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRELFGKDEQQRISKDLANICKTAATAGIIGWVYGGIPAFIHAKQQYIEQSQAEIYHNRFDAVQSAHRAATRGFIRYGWRWGWRTAVFVTIFNTVNTSLNVYRNKDALSHFVIAGAVTGSLFRINVGLRGLVAGGIIGALLGTPVGGLLMAFQKYSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDKD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Phosphorylation | VPPPAPRSFLCRALC CCCCCCHHHHHHHHH | 22.85 | 24719451 | |
71 | Phosphorylation | KDEQQRISKDLANIC HHHHHHHHHHHHHHH | 23.47 | 25599653 | |
113 | Phosphorylation | EQSQAEIYHNRFDAV HHHHHHHHHCCHHHH | 5.64 | 28064214 | |
128 | Phosphorylation | QSAHRAATRGFIRYG HHHHHHHHHCHHHCC | 30.27 | 21712546 | |
166 | Phosphorylation | YRNKDALSHFVIAGA CCCCCCHHHHHHHHH | 19.32 | 27251275 | |
175 | Phosphorylation | FVIAGAVTGSLFRIN HHHHHHHHCHHHHCC | 22.10 | 27251275 | |
177 | Phosphorylation | IAGAVTGSLFRINVG HHHHHHCHHHHCCCC | 18.24 | 27251275 | |
232 | Ubiquitination | RKALHELKLEEWKGR HHHHHHHCHHHHCCC | 51.36 | - | |
237 | Ubiquitination | ELKLEEWKGRLQVTE HHCHHHHCCCCHHHH | 37.12 | - | |
252 | Phosphorylation | HLPEKIESSLQEDEP HCHHHHHHHHCCCCC | 39.56 | 25850435 | |
253 | Phosphorylation | LPEKIESSLQEDEPE CHHHHHHHHCCCCCC | 22.68 | 28355574 | |
264 | Ubiquitination | DEPENDAKKIEALLN CCCCCHHHHHHHHHC | 58.09 | - | |
277 | Phosphorylation | LNLPRNPSVIDKQDK HCCCCCHHHCCCCCC | 34.94 | 19664994 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIDC1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIDC1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIDC1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...