UniProt ID | ATP5I_HUMAN | |
---|---|---|
UniProt AC | P56385 | |
Protein Name | ATP synthase subunit e, mitochondrial | |
Gene Name | ATP5I | |
Organism | Homo sapiens (Human). | |
Sequence Length | 69 | |
Subcellular Localization | Mitochondrion. Mitochondrion inner membrane. | |
Protein Description | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane.. | |
Protein Sequence | MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MVPPVQVSPLIKLGR CCCCCCCCHHHHHCH | 9.26 | 26074081 | |
12 | Ubiquitination | VQVSPLIKLGRYSAL CCCCHHHHHCHHHHH | 53.20 | 24816145 | |
17 | O-linked_Glycosylation | LIKLGRYSALFLGVA HHHHCHHHHHHHHHH | 19.69 | 30379171 | |
25 | Phosphorylation | ALFLGVAYGATRYNY HHHHHHHHCHHHHHC | 12.60 | - | |
28 | Phosphorylation | LGVAYGATRYNYLKP HHHHHCHHHHHCCCH | 29.35 | - | |
30 | Phosphorylation | VAYGATRYNYLKPRA HHHCHHHHHCCCHHH | 12.10 | 22817900 | |
32 | Phosphorylation | YGATRYNYLKPRAEE HCHHHHHCCCHHHHH | 13.73 | 22817900 | |
34 | Succinylation | ATRYNYLKPRAEEER HHHHHCCCHHHHHHH | 23.30 | 23954790 | |
34 | Ubiquitination | ATRYNYLKPRAEEER HHHHHCCCHHHHHHH | 23.30 | - | |
34 | Acetylation | ATRYNYLKPRAEEER HHHHHCCCHHHHHHH | 23.30 | 25825284 | |
48 | 2-Hydroxyisobutyrylation | RRIAAEEKKKQDELK HHHHHHHHHHHHHHH | 57.69 | - | |
49 | Ubiquitination | RIAAEEKKKQDELKR HHHHHHHHHHHHHHH | 59.97 | 24816145 | |
50 | Ubiquitination | IAAEEKKKQDELKRI HHHHHHHHHHHHHHH | 74.23 | 24816145 | |
55 | Ubiquitination | KKKQDELKRIARELA HHHHHHHHHHHHHHH | 39.45 | 25015289 | |
55 | 2-Hydroxyisobutyrylation | KKKQDELKRIARELA HHHHHHHHHHHHHHH | 39.45 | - | |
66 | Phosphorylation | RELAEDDSILK---- HHHHHHCCCCC---- | 41.99 | 25850435 | |
69 | Acetylation | AEDDSILK------- HHHCCCCC------- | 57.53 | 68909 | |
69 | Ubiquitination | AEDDSILK------- HHHCCCCC------- | 57.53 | 24816145 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATP5I_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATP5I_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATP5I_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RS16_HUMAN | RPS16 | physical | 22939629 | |
RS21_HUMAN | RPS21 | physical | 22939629 | |
RER1_HUMAN | RER1 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...