| UniProt ID | NDUA8_HUMAN | |
|---|---|---|
| UniProt AC | P51970 | |
| Protein Name | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 | |
| Gene Name | NDUFA8 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 172 | |
| Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein . Mitochondrion intermembrane space . Mitochondrion . |
|
| Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.. | |
| Protein Sequence | MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 14 | Ubiquitination | LPTLEELKVDEVKIS CCCHHHCCCCEEECC | 51.42 | - | |
| 19 | Ubiquitination | ELKVDEVKISSAVLK HCCCCEEECCHHHHH | 34.52 | 21890473 | |
| 19 | Ubiquitination | ELKVDEVKISSAVLK HCCCCEEECCHHHHH | 34.52 | 21890473 | |
| 19 | 2-Hydroxyisobutyrylation | ELKVDEVKISSAVLK HCCCCEEECCHHHHH | 34.52 | - | |
| 26 | Ubiquitination | KISSAVLKAAAHHYG ECCHHHHHHHHHHHC | 29.40 | - | |
| 38 | Acetylation | HYGAQCDKPNKEFML HHCCCCCCCCCCEEE | 59.10 | 25825284 | |
| 38 | Ubiquitination | HYGAQCDKPNKEFML HHCCCCCCCCCCEEE | 59.10 | - | |
| 41 | Acetylation | AQCDKPNKEFMLCRW CCCCCCCCCEEEEEC | 61.94 | 26051181 | |
| 41 | Ubiquitination | AQCDKPNKEFMLCRW CCCCCCCCCEEEEEC | 61.94 | - | |
| 51 | Ubiquitination | MLCRWEEKDPRRCLE EEEECCCCCHHHHHH | 62.61 | - | |
| 51 | Acetylation | MLCRWEEKDPRRCLE EEEECCCCCHHHHHH | 62.61 | 26051181 | |
| 61 | Acetylation | RRCLEEGKLVNKCAL HHHHHHCCHHHHHHH | 53.17 | 26051181 | |
| 61 | Ubiquitination | RRCLEEGKLVNKCAL HHHHHHCCHHHHHHH | 53.17 | 21890473 | |
| 65 | Acetylation | EEGKLVNKCALDFFR HHCCHHHHHHHHHHH | 17.26 | 25953088 | |
| 65 | Ubiquitination | EEGKLVNKCALDFFR HHCCHHHHHHHHHHH | 17.26 | 21890473 | |
| 65 | Ubiquitination | EEGKLVNKCALDFFR HHCCHHHHHHHHHHH | 17.26 | 21890473 | |
| 85 | Phosphorylation | CAEPFTEYWTCIDYT CCCCCCCCEEHHCHH | 11.71 | 29496907 | |
| 91 | Phosphorylation | EYWTCIDYTGQQLFR CCEEHHCHHHHHHHH | 7.89 | 29496907 | |
| 102 | Ubiquitination | QLFRHCRKQQAKFDE HHHHHHHHHHHCCCH | 52.75 | 21890473 | |
| 106 | Ubiquitination | HCRKQQAKFDECVLD HHHHHHHCCCHHHHH | 49.35 | 21890473 | |
| 106 | Ubiquitination | HCRKQQAKFDECVLD HHHHHHHCCCHHHHH | 49.35 | 21890473 | |
| 114 | Acetylation | FDECVLDKLGWVRPD CCHHHHHHHCCCCCC | 44.75 | 25038526 | |
| 114 | Ubiquitination | FDECVLDKLGWVRPD CCHHHHHHHCCCCCC | 44.75 | - | |
| 127 | Ubiquitination | PDLGELSKVTKVKTD CCHHHHHCCEECCCC | 67.55 | 21890473 | |
| 132 | Ubiquitination | LSKVTKVKTDRPLPE HHCCEECCCCCCCCC | 46.38 | - | |
| 142 | Phosphorylation | RPLPENPYHSRPRPD CCCCCCCCCCCCCCC | 24.82 | 27196784 | |
| 151 | Phosphorylation | SRPRPDPSPEIEGDL CCCCCCCCCCCCCCC | 42.41 | 29255136 | |
| 168 | Phosphorylation | ATHGSRFYFWTK--- CCCCCCEEEEEC--- | 9.33 | 27642862 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUA8_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUA8_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUA8_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...