dbPTM

NDUA1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NDUA1_HUMAN
UniProt AC	O15239
Protein Name	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
Gene Name	NDUFA1
Organism	Homo sapiens (Human).
Sequence Length	70
Subcellular Localization	Mitochondrion inner membrane Single-pass membrane protein Matrix side .
Protein Description	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone..
Protein Sequence	MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
55	Phosphorylation	MERDRRISGVDRYYV HHHHHCCCCCCHHHH	30.84	22817900
59	Methylation	RRISGVDRYYVSKGL HCCCCCCHHHHHCCC	23.44	115484677
60	Phosphorylation	RISGVDRYYVSKGLE CCCCCCHHHHHCCCC	12.07	29496907
61	Phosphorylation	ISGVDRYYVSKGLEN CCCCCHHHHHCCCCC	10.11	26437602
63	Phosphorylation	GVDRYYVSKGLENID CCCHHHHHCCCCCCC	12.60	-
64	Ubiquitination	VDRYYVSKGLENID- CCHHHHHCCCCCCC-	58.43	2190698

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NDUA1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NDUA1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NDUA1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of NDUA1_HUMAN !!

Drug and Disease Associations

Kegg Disease
H00473	Mitochondrial respiratory chain deficiencies (MRCD), including: Mitochondrial complex I deficiency (
OMIM Disease
252010	Mitochondrial complex I deficiency (MT-C1D)
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NDUA1_HUMAN

Related Literatures of Post-Translational Modification