| UniProt ID | NDUB7_HUMAN | |
|---|---|---|
| UniProt AC | P17568 | |
| Protein Name | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 | |
| Gene Name | NDUFB7 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 137 | |
| Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein . Mitochondrion intermembrane space . |
|
| Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.. | |
| Protein Sequence | MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Myristoylation | ------MGAHLVRRY ------CCHHHHHHH | 23.00 | - | |
| 24 | Phosphorylation | PDPLQMPTFPPDYGF CCCCCCCCCCCCCCC | 43.35 | - | |
| 29 | Phosphorylation | MPTFPPDYGFPERKE CCCCCCCCCCCCHHH | 26.83 | - | |
| 58 | Phosphorylation | LRLQLRDYCAHHLIR HHHHHHHHHHHHHHH | 5.77 | 28152594 | |
| 68 | Methylation | HHLIRLLKCKRDSFP HHHHHHHHCCCCCCC | 42.15 | 116252153 | |
| 73 | Phosphorylation | LLKCKRDSFPNFLAC HHHCCCCCCCCCCHH | 46.79 | 26657352 | |
| 81 | Ubiquitination | FPNFLACKQERHDWD CCCCCHHCHHHCCCC | 49.97 | 32142685 | |
| 86 | Ubiquitination | ACKQERHDWDYCEHR HHCHHHCCCCHHHCH | 46.28 | 22817900 | |
| 89 | Phosphorylation | QERHDWDYCEHRDYV HHHCCCCHHHCHHHH | 8.76 | 24927040 | |
| 100 | Ubiquitination | RDYVMRMKEFERERR HHHHHHHHHHHHHHH | 49.22 | - | |
| 117 | Acetylation | QRKKRREKKAAELAK HHHHHHHHHHHHHHC | 45.99 | 7971955 | |
| 124 | Ubiquitination | KKAAELAKGQGPGEV HHHHHHHCCCCCCCC | 65.47 | 22817900 | |
| 134 | Ubiquitination | GPGEVDPKVAL---- CCCCCCCCCCC---- | 35.36 | 29967540 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUB7_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUB7_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUB7_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NDUBA_HUMAN | NDUFB10 | physical | 22939629 | |
| QCR8_HUMAN | UQCRQ | physical | 22939629 | |
| TOM7_HUMAN | TOMM7 | physical | 22939629 | |
| AT5F1_HUMAN | ATP5F1 | physical | 26344197 | |
| VA0D1_HUMAN | ATP6V0D1 | physical | 26344197 | |
| COX41_HUMAN | COX4I1 | physical | 26344197 | |
| NDUAA_HUMAN | NDUFA10 | physical | 26344197 | |
| NDUB9_HUMAN | NDUFB9 | physical | 26344197 | |
| PHB2_HUMAN | PHB2 | physical | 26344197 | |
| QCR2_HUMAN | UQCRC2 | physical | 26344197 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
