UniProt ID | QCR8_HUMAN | |
---|---|---|
UniProt AC | O14949 | |
Protein Name | Cytochrome b-c1 complex subunit 8 | |
Gene Name | UQCRQ | |
Organism | Homo sapiens (Human). | |
Sequence Length | 82 | |
Subcellular Localization | Mitochondrion inner membrane. | |
Protein Description | This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.. | |
Protein Sequence | MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Methylation | REFGNLTRMRHVISY CCCCHHHHHCHHHEE | 24.25 | 115919565 | |
12 | Methylation | FGNLTRMRHVISYSL CCHHHHHCHHHEEEC | 20.03 | 115919569 | |
16 | Phosphorylation | TRMRHVISYSLSPFE HHHCHHHEEECCHHH | 13.95 | 28152594 | |
17 | Phosphorylation | RMRHVISYSLSPFEQ HHCHHHEEECCHHHH | 11.51 | 28152594 | |
18 | Phosphorylation | MRHVISYSLSPFEQR HCHHHEEECCHHHHH | 18.64 | 28152594 | |
20 | Phosphorylation | HVISYSLSPFEQRAY HHHEEECCHHHHHCC | 22.92 | 28152594 | |
25 | Methylation | SLSPFEQRAYPHVFT ECCHHHHHCCCCHHC | 28.96 | 115919573 | |
32 | Phosphorylation | RAYPHVFTKGIPNVL HCCCCHHCCCHHHHH | 27.54 | - | |
33 | Ubiquitination | AYPHVFTKGIPNVLR CCCCHHCCCHHHHHH | 43.29 | 23000965 | |
33 | Succinylation | AYPHVFTKGIPNVLR CCCCHHCCCHHHHHH | 43.29 | - | |
33 | Malonylation | AYPHVFTKGIPNVLR CCCCHHCCCHHHHHH | 43.29 | 26320211 | |
33 | Succinylation | AYPHVFTKGIPNVLR CCCCHHCCCHHHHHH | 43.29 | - | |
33 | Acetylation | AYPHVFTKGIPNVLR CCCCHHCCCHHHHHH | 43.29 | 25953088 | |
45 | Phosphorylation | VLRRIRESFFRVVPQ HHHHHHHHHHHHHHH | 21.60 | 24719451 | |
73 | Ubiquitination | EFERSKRKNPAAYEN HHHHHHCCCHHHHCC | 71.65 | 27667366 | |
73 | Acetylation | EFERSKRKNPAAYEN HHHHHHCCCHHHHCC | 71.65 | 26051181 | |
78 | Phosphorylation | KRKNPAAYENDK--- HCCCHHHHCCCC--- | 19.85 | 29496907 | |
82 | Acetylation | PAAYENDK------- HHHHCCCC------- | 74.04 | 2380467 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of QCR8_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of QCR8_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of QCR8_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
H00473 | Mitochondrial respiratory chain deficiencies (MRCD), including: Mitochondrial complex I deficiency ( | |||||
OMIM Disease | ||||||
615159 | Mitochondrial complex III deficiency, nuclear 4 (MC3DN4) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...