| UniProt ID | CYTN_HUMAN | |
|---|---|---|
| UniProt AC | P01037 | |
| Protein Name | Cystatin-SN | |
| Gene Name | CST1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 141 | |
| Subcellular Localization | Secreted . | |
| Protein Description | Human saliva appears to contain several cysteine proteinase inhibitors that are immunologically related to cystatin S but that differ in their specificity due to amino acid sequence differences. Cystatin SN, with a pI of 7.5, is a much better inhibitor of papain and dipeptidyl peptidase I than is cystatin S, although both inhibit ficin equally well.. | |
| Protein Sequence | MAQYLSTLLLLLATLAVALAWSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 22 | Phosphorylation | LAVALAWSPKEEDRI HHHHHCCCCCCCCCC | 22.08 | 24719451 | |
| 63 | Phosphorylation | NKATKDDYYRRPLRV HHCCCCCHHHHHHHH | 14.70 | 22817900 | |
| 64 | Phosphorylation | KATKDDYYRRPLRVL HCCCCCHHHHHHHHH | 13.72 | 22817900 | |
| 119 | Phosphorylation | LQKKQLCSFEIYEVP HHHCCCCCEEEEECC | 34.21 | 1898055 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYTN_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYTN_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYTN_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SGTA_HUMAN | SGTA | physical | 25416956 | |
| CYTS_HUMAN | CST4 | physical | 28514442 | |
| CATH_HUMAN | CTSH | physical | 28514442 | |
| CATL1_HUMAN | CTSL | physical | 28514442 | |
| CATL2_HUMAN | CTSV | physical | 28514442 | |
| CPLX4_HUMAN | CPLX4 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
