CATL2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CATL2_HUMAN
• UniProt AC: O60911
• Protein Name: Cathepsin L2
• Gene Name: CTSV
• Organism: Homo sapiens (Human).
• Sequence Length: 334
• Subcellular Localization: Lysosome .
• Protein Description: Cysteine protease. May have an important role in corneal physiology..
• Protein Sequence: MNLSLVLAAFCLGIASAVPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	N-linked_Glycosylation	------MNLSLVLAA ------CCHHHHHHH	38.03	-
2	N-linked_Glycosylation	------MNLSLVLAA ------CCHHHHHHH	38.03	10029531
35	Phosphorylation	KWYQWKATHRRLYGA CCEEHHHHHHHHHCC	16.52	-
74	Phosphorylation	SQGKHGFTMAMNAFG CCCHHHHHEEEHHHC	14.49	29759185
84	Phosphorylation	MNAFGDMTNEEFRQM EHHHCCCCHHHHHHH	44.19	29759185
127	Phosphorylation	WRKKGYVTPVKNQKQ HHHCCCEECCCCCCC	17.55	29396449
221	N-linked_Glycosylation	RPENSVANDTGFTVV CCCCCCCCCCCCEEE	45.26	10029531
221	N-linked_Glycosylation	RPENSVANDTGFTVV CCCCCCCCCCCCEEE	45.26	10029531
292	N-linked_Glycosylation	GFEGANSNNSKYWLV CCCCCCCCCCCEEEE	57.51	10029531
292	N-linked_Glycosylation	GFEGANSNNSKYWLV CCCCCCCCCCCEEEE	57.51	10029531
296	Phosphorylation	ANSNNSKYWLVKNSW CCCCCCCEEEEECCC	12.09	28509920
302	Phosphorylation	KYWLVKNSWGPEWGS CEEEEECCCCCCCCC	27.91	28509920
312	Phosphorylation	PEWGSNGYVKIAKDK CCCCCCCCEEEEECC	11.65	28509920

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CATL2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CATL2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CATL2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CATL1_HUMAN	CTSL	physical	26186194
DPB1_HUMAN	HLA-DPB1	physical	26186194
SSRD_HUMAN	SSR4	physical	26344197
CATL1_HUMAN	CTSL	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.