| UniProt ID | CPLX4_HUMAN | |
|---|---|---|
| UniProt AC | Q7Z7G2 | |
| Protein Name | Complexin-4 | |
| Gene Name | CPLX4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 160 | |
| Subcellular Localization |
Membrane Lipid-anchor. Cell junction, synapse. Enriched at the synaptic terminal.. |
|
| Protein Description | Positively regulates a late step in synaptic vesicle exocytosis.. | |
| Protein Sequence | MAFLMKSMISNQVKNLGFGGGSEENKEEGGASDPAAAQGMTREEYEEYQKQMIEEKMERDAAFTQKKAERACLRVHLREKYRLPKSEMDENQIQMAGDDVDLPEDLRKMVDEDQEEEEDKDSILGQIQNLQNMDLDTIKEKAQATFTEIKQTAEQKCSVM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 45 | Phosphorylation | QGMTREEYEEYQKQM CCCCHHHHHHHHHHH | 14.87 | 23879269 | |
| 48 | Phosphorylation | TREEYEEYQKQMIEE CHHHHHHHHHHHHHH | 14.74 | 23879269 | |
| 152 | Phosphorylation | TFTEIKQTAEQKCSV HHHHHHHHHHHHHCC | 27.45 | 27461979 | |
| 157 | Methylation | KQTAEQKCSVM---- HHHHHHHHCCC---- | 3.56 | - | |
| 157 | Farnesylation | KQTAEQKCSVM---- HHHHHHHHCCC---- | 3.56 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CPLX4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CPLX4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CPLX4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SPTB1_HUMAN | SPTB | physical | 28514442 | |
| EFHD1_HUMAN | EFHD1 | physical | 28514442 | |
| IPPK_HUMAN | IPPK | physical | 28514442 | |
| CBX5_HUMAN | CBX5 | physical | 28514442 | |
| MK03_HUMAN | MAPK3 | physical | 28514442 | |
| MICU2_HUMAN | MICU2 | physical | 28514442 | |
| HSP7C_HUMAN | HSPA8 | physical | 28514442 | |
| ACTA_HUMAN | ACTA2 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
