EFHD1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: EFHD1_HUMAN
• UniProt AC: Q9BUP0
• Protein Name: EF-hand domain-containing protein D1
• Gene Name: EFHD1
• Organism: Homo sapiens (Human).
• Sequence Length: 239
• Subcellular Localization: Mitochondrion inner membrane .
• Protein Description: Acts as a calcium sensor for mitochondrial flash (mitoflash) activation, an event characterized by stochastic bursts of superoxide production. [PubMed: 26975899 May play a role in neuronal differentiation (By similarity]
• Protein Sequence: MASEELACKLERRLRREEAEESGPQLAPLGAPAPEPKPEPEPPARAPTASADAELSAQLSRRLDINEGAARPRRCRVFNPYTEFPEFSRRLIKDLESMFKLYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLIFHKAAAGELQEDSGLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFNT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MASEELACKL -----CCHHHHHHHH	30.24	24719451
22	Phosphorylation	RREEAEESGPQLAPL HHHHHHHHCCCCCCC	47.48	20166139
48	Phosphorylation	EPPARAPTASADAEL CCCCCCCCCCCCHHH	32.06	20068231
50	Phosphorylation	PARAPTASADAELSA CCCCCCCCCCHHHHH	29.20	20068231
56	Phosphorylation	ASADAELSAQLSRRL CCCCHHHHHHHHHHC	12.89	20068231
60	Phosphorylation	AELSAQLSRRLDINE HHHHHHHHHHCCCCC	11.86	20068231
81	Phosphorylation	RCRVFNPYTEFPEFS CEEECCCCCCCHHHH	21.72	27642862
82	Phosphorylation	CRVFNPYTEFPEFSR EEECCCCCCCHHHHH	32.19	28348404
121	Ubiquitination	ELKLMMEKLGAPQTH HHHHHHHHHCCCCCH	34.03	-
147	Phosphorylation	EDFDGKLSFREFLLI CCCCCCCCHHHHHHH	26.24	25554490
157	Ubiquitination	EFLLIFHKAAAGELQ HHHHHHHHHHCCCCC	29.04	22053931
200	Phosphorylation	EAKVQALSSASKFEA HHHHHHHHHCHHHHH	27.20	24719451
201	Phosphorylation	AKVQALSSASKFEAE HHHHHHHHCHHHHHH	37.09	14702039
203	Phosphorylation	VQALSSASKFEAELK HHHHHHCHHHHHHHH	39.56	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of EFHD1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of EFHD1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of EFHD1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TRHY_HUMAN	TCHH	physical	17353931
KT33B_HUMAN	KRT33B	physical	17353931

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.