| UniProt ID | COX1_HUMAN | |
|---|---|---|
| UniProt AC | P00395 | |
| Protein Name | Cytochrome c oxidase subunit 1 | |
| Gene Name | MT-CO1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 513 | |
| Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein. |
|
| Protein Description | Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.. | |
| Protein Sequence | MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGSNMKWSAAVLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 17 | Phosphorylation | TNHKDIGTLYLLFGA CCCCCHHHHHHHHHH | 16.74 | - | |
| 19 | Phosphorylation | HKDIGTLYLLFGAWA CCCHHHHHHHHHHHH | 10.95 | - | |
| 31 | Phosphorylation | AWAGVLGTALSLLIR HHHHHHHHHHHHHHH | 21.92 | - | |
| 34 | Phosphorylation | GVLGTALSLLIRAEL HHHHHHHHHHHHHHH | 20.75 | - | |
| 279 | Phosphorylation | GMVWAMMSIGFLGFI HHHHHHHHHHHHHHH | 13.38 | 30257219 | |
| 316 | Phosphorylation | TMIIAIPTGVKVFSW EEEEEECCCCHHHHH | 48.79 | 29514088 | |
| 330 | Phosphorylation | WLATLHGSNMKWSAA HHHHHCCCCCHHHHH | 24.01 | - | |
| 409 | Phosphorylation | GYTLDQTYAKIHFTI CCCCCHHHHCCEEEE | 10.56 | 25332170 | |
| 415 | Phosphorylation | TYAKIHFTIMFIGVN HHHCCEEEEEEEEEC | 9.43 | 25332170 | |
| 434 | Phosphorylation | PQHFLGLSGMPRRYS CHHHHCCCCCCCCCC | 31.11 | 25332170 | |
| 455 | O-linked_Glycosylation | TTWNILSSVGSFISL HHHHHHHHHHHHHHH | 27.35 | 28510447 | |
| 489 | Phosphorylation | VLMVEEPSMNLEWLY EEEEECCCCCCHHHH | 24.47 | 25262027 | |
| 496 | Phosphorylation | SMNLEWLYGCPPPYH CCCCHHHHCCCCCCC | 20.11 | 25262027 | |
| 502 | Phosphorylation | LYGCPPPYHTFEEPV HHCCCCCCCCCCCCC | 21.18 | 25262027 | |
| 504 | Phosphorylation | GCPPPYHTFEEPVYM CCCCCCCCCCCCCCC | 27.22 | 25262027 | |
| 510 | Phosphorylation | HTFEEPVYMKS---- CCCCCCCCCCC---- | 15.00 | 25262027 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PRDX4_HUMAN | PRDX4 | physical | 21988832 | |
| COX2_HUMAN | COX2 | physical | 22252130 | |
| NDUB8_HUMAN | NDUFB8 | physical | 22252130 | |
| COX41_HUMAN | COX4I1 | physical | 22252130 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
