TOM7_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TOM7_HUMAN
• UniProt AC: Q9P0U1
• Protein Name: Mitochondrial import receptor subunit TOM7 homolog
• Gene Name: TOMM7
• Organism: Homo sapiens (Human).
• Sequence Length: 55
• Subcellular Localization: Mitochondrion outer membrane ; Single-pass membrane protein .
• Protein Description: Required for assembly and stability of the TOM complex. Positive regulator of PRKN translocation to damaged mitochondria. Acts probably by stabilizing PINK1 on the outer membrane of depolarized mitochondria..
• Protein Sequence: MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Ubiquitination	--MVKLSKEAKQRLQ --CCCCCHHHHHHHH	72.61	-
17	Ubiquitination	QRLQQLFKGSQFAIR HHHHHHHCCCHHHHH	67.27	21890473
17	Acetylation	QRLQQLFKGSQFAIR HHHHHHHCCCHHHHH	67.27	26051181
19	Phosphorylation	LQQLFKGSQFAIRWG HHHHHCCCHHHHHHC	23.79	20068231

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TOM7_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TOM7_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TOM7_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UCRI_HUMAN	UQCRFS1	physical	22939629

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.