dbPTM

NDUB1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NDUB1_HUMAN
UniProt AC	O75438
Protein Name	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1
Gene Name	NDUFB1
Organism	Homo sapiens (Human).
Sequence Length	58
Subcellular Localization	Mitochondrion inner membrane Single-pass membrane protein Matrix side .
Protein Description	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone..
Protein Sequence	MVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
31	Phosphorylation	GCYLDRKSDERLTAF EEEECCCCCHHHHHH	45.67	26437602
36	Phosphorylation	RKSDERLTAFRNKSM CCCCHHHHHHHCHHH	29.94	26437602
41	2-Hydroxyisobutyrylation	RLTAFRNKSMLFKRE HHHHHHCHHHHHCCC	32.74	-
42	Phosphorylation	LTAFRNKSMLFKREL HHHHHCHHHHHCCCC	25.02	-
52	Phosphorylation	FKRELQPSEEVTWK- HCCCCCCCCCCCCC-	33.17	25159151
88	Ubiquitination	------------------------------------- -------------------------------------		-
89	Phosphorylation	-------------------------------------- --------------------------------------		-
99	Phosphorylation	------------------------------------------------ ------------------------------------------------		-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NDUB1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NDUB1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NDUB1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NDUB1_HUMAN

Related Literatures of Post-Translational Modification