UniProt ID | NDUB5_HUMAN | |
---|---|---|
UniProt AC | O43674 | |
Protein Name | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial | |
Gene Name | NDUFB5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 189 | |
Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein Matrix side . |
|
Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.. | |
Protein Sequence | MAAMSLLRRVSVTAVAALSGRPLGTRLGFGGFLTRGFPKAAAPVRHSGDHGKRLFVIRPSRFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MAAMSLLRRVSV ---CCHHHHHHHHHH | 21.37 | 24043423 | |
34 | Phosphorylation | LGFGGFLTRGFPKAA ECCCCCCCCCCCCCC | 26.87 | 22210691 | |
39 | Ubiquitination | FLTRGFPKAAAPVRH CCCCCCCCCCCCCEE | 48.69 | - | |
126 | Phosphorylation | RWIARNFYDSPEKIY HHHHHHCCCCHHHHH | 21.04 | 29214152 | |
128 | Phosphorylation | IARNFYDSPEKIYER HHHHCCCCHHHHHHH | 24.47 | 21815630 | |
131 | Ubiquitination | NFYDSPEKIYERTMA HCCCCHHHHHHHHHH | 54.71 | - | |
131 | Acetylation | NFYDSPEKIYERTMA HCCCCHHHHHHHHHH | 54.71 | 27452117 | |
133 | Phosphorylation | YDSPEKIYERTMAVL CCCHHHHHHHHHHHH | 15.49 | 29496907 | |
146 | Acetylation | VLQIEAEKAELRVKE HHHHHHHHHCCEEEE | 54.96 | 26822725 | |
152 | Ubiquitination | EKAELRVKELEVRKL HHHCCEEEEEEEEEE | 50.58 | - | |
152 | 2-Hydroxyisobutyrylation | EKAELRVKELEVRKL HHHCCEEEEEEEEEE | 50.58 | - | |
176 | Ubiquitination | YYYETIDKELIDHSP EEEEECCHHHHCCCC | 51.04 | - | |
182 | Phosphorylation | DKELIDHSPKATPDN CHHHHCCCCCCCCCC | 25.09 | 25159151 | |
184 | Acetylation | ELIDHSPKATPDN-- HHHCCCCCCCCCC-- | 68.83 | 27452117 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUB5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUB5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUB5_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...