UniProt ID | F174A_HUMAN | |
---|---|---|
UniProt AC | Q8TBP5 | |
Protein Name | Membrane protein FAM174A | |
Gene Name | FAM174A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 190 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein . |
|
Protein Description | ||
Protein Sequence | MKASQCCCCLSHLLASVLLLLLLPELSGPLAVLLQAAEAAPGLGPPDPRPRTLPPLPPGPTPAQQPGRGLAEAAGPRGSEGGNGSNPVAGLETDDHGGKAGEGSVGGGLAVSPNPGDKPMTQRALTVLMVVSGAVLVYFVVRTVRMRRRNRKTRRYGVLDTNIENMELTPLEQDDEDDDNTLFDANHPRR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
52 | O-linked_Glycosylation | PPDPRPRTLPPLPPG CCCCCCCCCCCCCCC | 46.42 | 55830749 | |
61 | O-linked_Glycosylation | PPLPPGPTPAQQPGR CCCCCCCCCCCCCCC | 36.85 | 55830755 | |
83 | N-linked_Glycosylation | PRGSEGGNGSNPVAG CCCCCCCCCCCCCCC | 62.67 | UniProtKB CARBOHYD | |
132 | Phosphorylation | LTVLMVVSGAVLVYF HHHHHHHCHHHHHHH | 15.04 | - | |
138 | Phosphorylation | VSGAVLVYFVVRTVR HCHHHHHHHHHHHHH | 6.11 | - | |
169 | Phosphorylation | NIENMELTPLEQDDE CCCCCEECCCCCCCC | 16.72 | 24275569 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of F174A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of F174A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of F174A_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...