S39AB_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: S39AB_HUMAN
• UniProt AC: Q8N1S5
• Protein Name: Zinc transporter ZIP11
• Gene Name: SLC39A11
• Organism: Homo sapiens (Human).
• Sequence Length: 342
• Subcellular Localization: Cell membrane ; Multi-pass membrane protein . Nucleus . Cytoplasm . Golgi apparatus .
• Protein Description: Functions as a cellular zinc transporter..
• Protein Sequence: MLQGHSSVFQALLGTFFTWGMTAAGAALVFVFSSGQRRILDGSLGFAAGVMLAASYWSLLAPAVEMATSSGGFGAFAFFPVAVGFTLGAAFVYLADLLMPHLGAAEDPQTTLALNFGSTLMKKKSDPEGPALLFPESELSIRIGRAGLLSDKSENGEAYQRKKAAATGLPEGPAVPVPSRGNLAQPGGSSWRRIALLILAITIHNVPEGLAVGVGFGAIEKTASATFESARNLAIGIGIQNFPEGLAVSLPLRGAGFSTWRAFWYGQLSGMVEPLAGVFGAFAVVLAEPILPYALAFAAGAMVYVVMDDIIPEAQISGNGKLASWASILGFVVMMSLDVGLG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
72	Ubiquitination	EMATSSGGFGAFAFF HHHHCCCCCCHHHHH	21.55	23503661
73	Ubiquitination	MATSSGGFGAFAFFP HHHCCCCCCHHHHHH	7.92	23503661
74	Ubiquitination	ATSSGGFGAFAFFPV HHCCCCCCHHHHHHH	24.06	23503661
113	Ubiquitination	EDPQTTLALNFGSTL CCCCCEEEECCCCHH	9.81	27667366
122	Ubiquitination	NFGSTLMKKKSDPEG CCCCHHCCCCCCCCC	61.23	23503661
123 (in isoform 2)	Ubiquitination	-	43.47	-
123	Ubiquitination	FGSTLMKKKSDPEGP CCCHHCCCCCCCCCC	43.47	23503661
124 (in isoform 1)	Ubiquitination	-	55.35	21906983
124 (in isoform 2)	Ubiquitination	-	55.35	21906983
124	Ubiquitination	GSTLMKKKSDPEGPA CCHHCCCCCCCCCCC	55.35	21906983
125	Phosphorylation	STLMKKKSDPEGPAL CHHCCCCCCCCCCCC	68.24	30266825
137	Phosphorylation	PALLFPESELSIRIG CCCCCCHHHHHHEEE	44.04	28857561
140	Phosphorylation	LFPESELSIRIGRAG CCCHHHHHHEEECCH	13.03	24719451
145 (in isoform 2)	Ubiquitination	-	24.10	21906983
146 (in isoform 2)	Phosphorylation	-	14.05	27251275
152	Ubiquitination	RAGLLSDKSENGEAY CCHHCCCCCCCCCHH	57.18	21906983
152 (in isoform 1)	Ubiquitination	-	57.18	21906983
153	Phosphorylation	AGLLSDKSENGEAYQ CHHCCCCCCCCCHHH	41.08	27251275
156	Ubiquitination	LSDKSENGEAYQRKK CCCCCCCCCHHHHHH	19.50	27667366
156 (in isoform 2)	Ubiquitination	-	19.50	21906983
163	Ubiquitination	GEAYQRKKAAATGLP CCHHHHHHHHHCCCC	45.51	2190698
163 (in isoform 1)	Ubiquitination	-	45.51	21906983
179	Phosphorylation	GPAVPVPSRGNLAQP CCCCCCCCCCCCCCC	53.72	22210691
224	Phosphorylation	GAIEKTASATFESAR CHHHHHHCCHHHHHH	32.83	23532336
229	Phosphorylation	TASATFESARNLAIG HHCCHHHHHHHHHHE	28.47	23532336
249	Phosphorylation	FPEGLAVSLPLRGAG CCCCEEEECCCCCCC	20.75	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of S39AB_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of S39AB_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of S39AB_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PON2_HUMAN	PON2	physical	28514442
G3PT_HUMAN	GAPDHS	physical	28514442
HUTH_HUMAN	HAL	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.