UniProt ID | MD2L2_HUMAN | |
---|---|---|
UniProt AC | Q9UI95 | |
Protein Name | Mitotic spindle assembly checkpoint protein MAD2B | |
Gene Name | MAD2L2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 211 | |
Subcellular Localization | Nucleus . Cytoplasm, cytoskeleton, spindle . Cytoplasm . Chromosome . Recruited to sites of chromosomal double-stranded breaks during G1 and S phase of the cell cycle. | |
Protein Description | Adapter protein able to interact with different proteins and involved in different biological processes. [PubMed: 11459825] | |
Protein Sequence | MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
44 | Ubiquitination | YPVGIFQKRKKYNVP CCCCCEECCCCCCCC | 56.27 | 21890473 | |
44 | Ubiquitination | YPVGIFQKRKKYNVP CCCCCEECCCCCCCC | 56.27 | 21890473 | |
47 | Ubiquitination | GIFQKRKKYNVPVQM CCEECCCCCCCCCEE | 46.20 | - | |
48 | Phosphorylation | IFQKRKKYNVPVQMS CEECCCCCCCCCEEE | 25.16 | 22210691 | |
63 | Phosphorylation | CHPELNQYIQDTLHC CCHHHHHHHHHHHHH | 10.24 | 22210691 | |
67 | Phosphorylation | LNQYIQDTLHCVKPL HHHHHHHHHHHHHHH | 11.30 | 22210691 | |
72 | Ubiquitination | QDTLHCVKPLLEKND HHHHHHHHHHHHCCC | 35.03 | - | |
90 | Ubiquitination | VVVVILDKEHRPVEK EEEEEECCCCCCCHH | 52.56 | 21890473 | |
90 | Ubiquitination | VVVVILDKEHRPVEK EEEEEECCCCCCCHH | 52.56 | 21890473 | |
162 | Ubiquitination | AATRNMEKIQVIKDF HHHCCHHHEEEECCC | 27.89 | 21890473 | |
167 | Ubiquitination | MEKIQVIKDFPWILA HHHEEEECCCCEEEE | 55.23 | 21890473 | |
190 | Ubiquitination | DPRLIPLKTMTSDIL CCCEEECCCCCHHHH | 30.78 | 21890473 | |
190 | Ubiquitination | DPRLIPLKTMTSDIL CCCEEECCCCCHHHH | 30.78 | 21890473 | |
190 | Acetylation | DPRLIPLKTMTSDIL CCCEEECCCCCHHHH | 30.78 | 25953088 | |
191 | Phosphorylation | PRLIPLKTMTSDILK CCEEECCCCCHHHHH | 33.11 | 26552605 | |
193 | Phosphorylation | LIPLKTMTSDILKMQ EEECCCCCHHHHHHH | 28.60 | 30622161 | |
194 | Phosphorylation | IPLKTMTSDILKMQL EECCCCCHHHHHHHH | 16.31 | 30622161 | |
202 | Phosphorylation | DILKMQLYVEERAHK HHHHHHHHHHHHHHC | 6.74 | 24719451 | |
211 | Phosphorylation | EERAHKGS------- HHHHHCCC------- | 41.68 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MD2L2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MD2L2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MD2L2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...