UniProt ID | PDC10_HUMAN | |
---|---|---|
UniProt AC | Q9BUL8 | |
Protein Name | Programmed cell death protein 10 | |
Gene Name | PDCD10 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 212 | |
Subcellular Localization |
Cytoplasm. Golgi apparatus membrane Peripheral membrane protein Cytoplasmic side. Cell membrane Peripheral membrane protein Cytoplasmic side. Partially co-localizes with endogenous PXN at the leading edges of migrating cells. |
|
Protein Description | Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and STK26 activity. [PubMed: 27807006 Important for cell migration, and for normal structure and assembly of the Golgi complex] | |
Protein Sequence | MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MRMTMEEMKNE ----CCCCHHHHHHH | 15.86 | 23401153 | |
27 | Phosphorylation | MPLYAVMYPVFNELE HHHHHHHHHHHHHHH | 6.94 | 22210691 | |
39 | Phosphorylation | ELERVNLSAAQTLRA HHHHCCCCHHHHHHH | 19.16 | 22210691 | |
43 | Phosphorylation | VNLSAAQTLRAAFIK CCCCHHHHHHHHHHH | 17.31 | 19370760 | |
50 | Ubiquitination | TLRAAFIKAEKENPG HHHHHHHHHHHHCCC | 44.00 | - | |
53 | 2-Hydroxyisobutyrylation | AAFIKAEKENPGLTQ HHHHHHHHHCCCCCH | 68.59 | - | |
53 | Ubiquitination | AAFIKAEKENPGLTQ HHHHHHHHHCCCCCH | 68.59 | - | |
64 | Sulfoxidation | GLTQDIIMKILEKKS CCCHHHHHHHHHHCC | 1.95 | 21406390 | |
65 | Ubiquitination | LTQDIIMKILEKKSV CCHHHHHHHHHHCCC | 33.46 | - | |
70 | Ubiquitination | IMKILEKKSVEVNFT HHHHHHHCCCCCCCC | 50.81 | 21890473 | |
106 | Ubiquitination | EFQDLNEKARALKQI HHHHHHHHHHHHHHH | 41.94 | - | |
106 | 2-Hydroxyisobutyrylation | EFQDLNEKARALKQI HHHHHHHHHHHHHHH | 41.94 | - | |
111 | 2-Hydroxyisobutyrylation | NEKARALKQILSKIP HHHHHHHHHHHHCCC | 34.02 | - | |
111 | Acetylation | NEKARALKQILSKIP HHHHHHHHHHHHCCC | 34.02 | 27452117 | |
115 | Phosphorylation | RALKQILSKIPDEIN HHHHHHHHCCCHHHH | 30.12 | 24719451 | |
116 | Ubiquitination | ALKQILSKIPDEIND HHHHHHHCCCHHHHH | 55.61 | - | |
124 | Methylation | IPDEINDRVRFLQTI CCHHHHHHHHHHHHH | 19.61 | 115486707 | |
132 | Ubiquitination | VRFLQTIKDIASAIK HHHHHHHHHHHHHHH | 46.61 | 21890473 | |
150 | Ubiquitination | DTVNNVFKKYQYQNR HHHHHHHHHHHHHHH | 46.41 | 21890473 | |
150 | Succinylation | DTVNNVFKKYQYQNR HHHHHHHHHHHHHHH | 46.41 | 23954790 | |
172 | Malonylation | KEFVKYSKSFSDTLK HHHHHHCCCHHHHHH | 53.05 | 26320211 | |
172 | Ubiquitination | KEFVKYSKSFSDTLK HHHHHHCCCHHHHHH | 53.05 | - | |
177 | Phosphorylation | YSKSFSDTLKTYFKD HCCCHHHHHHHHCCC | 29.02 | 26503892 | |
179 | Ubiquitination | KSFSDTLKTYFKDGK CCHHHHHHHHCCCCC | 43.18 | 19608861 | |
179 | Acetylation | KSFSDTLKTYFKDGK CCHHHHHHHHCCCCC | 43.18 | 19608861 | |
180 | Phosphorylation | SFSDTLKTYFKDGKA CHHHHHHHHCCCCCE | 36.98 | 26503892 | |
181 | Phosphorylation | FSDTLKTYFKDGKAI HHHHHHHHCCCCCEE | 13.67 | 26503892 | |
183 | Ubiquitination | DTLKTYFKDGKAINV HHHHHHCCCCCEEEE | 55.98 | - | |
186 | Sumoylation | KTYFKDGKAINVFVS HHHCCCCCEEEEEEE | 57.11 | 28112733 | |
201 | Phosphorylation | ANRLIHQTNLILQTF HHHHHHHHHHHHHHH | 20.17 | - |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PDC10_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PDC10_HUMAN !! |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-179, AND MASS SPECTROMETRY. |