UniProt ID | PHOCN_HUMAN | |
---|---|---|
UniProt AC | Q9Y3A3 | |
Protein Name | MOB-like protein phocein | |
Gene Name | MOB4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 225 | |
Subcellular Localization |
Cytoplasm, perinuclear region . Membrane Peripheral membrane protein . Golgi apparatus, Golgi stack membrane Peripheral membrane protein . In a perinuclear punctate pattern. Associated with membranes and the Golgi stacks. |
|
Protein Description | May play a role in membrane trafficking, specifically in membrane budding reactions.. | |
Protein Sequence | MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Sulfoxidation | -----MVMAEGTAVL -----CCCCCCCEEE | 2.44 | 21406390 | |
7 | Phosphorylation | -MVMAEGTAVLRRNR -CCCCCCCEEEECCC | 12.71 | 22210691 | |
21 | Phosphorylation | RPGTKAQDFYNWPDE CCCCCHHHHCCCCCC | 53.51 | 27642862 | |
21 (in isoform 3) | Phosphorylation | - | 53.51 | 28674419 | |
29 | Phosphorylation | FYNWPDESFDEMDST HCCCCCCCHHHHHHH | 45.43 | 28348404 | |
35 | Phosphorylation | ESFDEMDSTLAVQQY CCHHHHHHHHHHHHH | 24.82 | 28348404 | |
36 | Phosphorylation | SFDEMDSTLAVQQYI CHHHHHHHHHHHHHH | 17.93 | 28348404 | |
42 | Phosphorylation | STLAVQQYIQQNIRA HHHHHHHHHHHHHHH | 5.43 | 27050516 | |
108 | Acetylation | TATEQWIFLCAAHKT CHHHHHHHHHHHCCC | 4.12 | 19608861 | |
114 | Acetylation | IFLCAAHKTPKECPA HHHHHHCCCCCCCCC | 62.89 | 26051181 | |
117 | Acetylation | CAAHKTPKECPAIDY HHHCCCCCCCCCCCC | 76.74 | 26051181 | |
119 | Acetylation | AHKTPKECPAIDYTR HCCCCCCCCCCCCCC | 3.26 | 19608861 | |
138 | Phosphorylation | GAACLLNSNKYFPSR HHHHHHCCCCCCCCC | 34.37 | 28152594 | |
140 | Malonylation | ACLLNSNKYFPSRVS HHHHCCCCCCCCCEE | 48.35 | 26320211 | |
140 | Ubiquitination | ACLLNSNKYFPSRVS HHHHCCCCCCCCCEE | 48.35 | 19608861 | |
140 | Acetylation | ACLLNSNKYFPSRVS HHHHCCCCCCCCCEE | 48.35 | 23954790 | |
141 | Phosphorylation | CLLNSNKYFPSRVSI HHHCCCCCCCCCEEE | 25.60 | 28152594 | |
144 | Phosphorylation | NSNKYFPSRVSIKES CCCCCCCCCEEECHH | 35.10 | 28152594 | |
147 | Phosphorylation | KYFPSRVSIKESSVA CCCCCCEEECHHHHH | 27.17 | 28450419 | |
149 | Ubiquitination | FPSRVSIKESSVAKL CCCCEEECHHHHHHH | 44.00 | - | |
155 | Malonylation | IKESSVAKLGSVCRR ECHHHHHHHHHHHHH | 51.75 | 26320211 | |
155 | Acetylation | IKESSVAKLGSVCRR ECHHHHHHHHHHHHH | 51.75 | 25953088 | |
192 | Phosphorylation | TFLCHRFTKFVMKYN HHHHHHHHHHHHHHC | 24.43 | 24719451 | |
198 | Phosphorylation | FTKFVMKYNLMSKDN HHHHHHHHCCCCCCC | 8.74 | - | |
218 | Phosphorylation | LEEEVQNSVSGESEA CHHHHHHHCCCCCCC | 10.68 | 28348404 | |
220 | Phosphorylation | EEVQNSVSGESEA-- HHHHHHCCCCCCC-- | 36.34 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PHOCN_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PHOCN_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PHOCN_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-140, AND MASS SPECTROMETRY. |