UniProt ID | MED10_HUMAN | |
---|---|---|
UniProt AC | Q9BTT4 | |
Protein Name | Mediator of RNA polymerase II transcription subunit 10 | |
Gene Name | MED10 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 135 | |
Subcellular Localization | Nucleus . | |
Protein Description | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.. | |
Protein Sequence | MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAEKFDHLE ------CHHHHHHHH | 28.78 | - | |
4 | Acetylation | ----MAEKFDHLEEH ----CHHHHHHHHHH | 46.70 | 25953088 | |
4 | Ubiquitination | ----MAEKFDHLEEH ----CHHHHHHHHHH | 46.70 | 33845483 | |
14 | Ubiquitination | HLEEHLEKFVENIRQ HHHHHHHHHHHHHHH | 62.16 | 32015554 | |
53 | Ubiquitination | TGLQDIDKCRQQLHD HCHHHHHHHHHHHCC | 31.48 | 29967540 | |
82 | Ubiquitination | RNPQLYTKECLERAL CCCHHCCHHHHHHHH | 32.64 | 27667366 | |
91 | Ubiquitination | CLERALAKNEQVKGK HHHHHHHHCCHHCCC | 62.96 | 27667366 | |
98 | Acetylation | KNEQVKGKIDTMKKF HCCHHCCCHHHHHHH | 31.52 | 30590367 | |
98 | Ubiquitination | KNEQVKGKIDTMKKF HCCHHCCCHHHHHHH | 31.52 | - | |
106 | Ubiquitination | IDTMKKFKSLLIQEL HHHHHHHHHHHHHHH | 49.42 | 29967540 | |
115 | Ubiquitination | LLIQELSKVFPEDMA HHHHHHHHHCHHHHH | 61.59 | 22817900 | |
123 | Ubiquitination | VFPEDMAKYRSIRGE HCHHHHHHHHHHCCC | 34.26 | 29967540 | |
135 | Phosphorylation | RGEDHPPS------- CCCCCCCC------- | 58.25 | 22617229 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MED10_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MED10_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MED10_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. |