UniProt ID | MED11_HUMAN | |
---|---|---|
UniProt AC | Q9P086 | |
Protein Name | Mediator of RNA polymerase II transcription subunit 11 | |
Gene Name | MED11 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 117 | |
Subcellular Localization | Nucleus . | |
Protein Description | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.. | |
Protein Sequence | MATYSLANERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQAAAFTASVQHVEAELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVARTCEQMLEN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MATYSLANE ------CCCHHHHHH | 18.42 | 22814378 | |
4 | Phosphorylation | ----MATYSLANERL ----CCCHHHHHHHH | 7.67 | 27642862 | |
69 | Phosphorylation | ELSAQIRYLTQVATG HHHHHHHHHHHHHCC | 18.74 | 23532336 | |
82 | Phosphorylation | TGQPHEGSSYSSRKD CCCCCCCCCCCCHHH | 24.10 | 23532336 | |
84 | Phosphorylation | QPHEGSSYSSRKDCQ CCCCCCCCCCHHHHH | 16.62 | 18452278 | |
85 | Phosphorylation | PHEGSSYSSRKDCQM CCCCCCCCCHHHHHH | 26.14 | 28555341 | |
95 | Acetylation | KDCQMALKRVDYARL HHHHHHHHHHCHHHH | 40.62 | 25953088 | |
103 | Acetylation | RVDYARLKLSDVART HHCHHHHHHHHHHHH | 40.15 | 25953088 | |
103 | Ubiquitination | RVDYARLKLSDVART HHCHHHHHHHHHHHH | 40.15 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MED11_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MED11_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MED11_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
MED29_HUMAN | MED29 | physical | 22939629 | |
MED1_HUMAN | MED1 | physical | 22939629 | |
MED8_HUMAN | MED8 | physical | 22939629 | |
MED21_HUMAN | MED21 | physical | 22939629 | |
MED17_HUMAN | MED17 | physical | 22939629 | |
MED6_HUMAN | MED6 | physical | 22939629 | |
MED4_HUMAN | MED4 | physical | 22939629 | |
MED24_HUMAN | MED24 | physical | 22939629 | |
MED16_HUMAN | MED16 | physical | 22939629 | |
MED14_HUMAN | MED14 | physical | 22939629 | |
MED18_HUMAN | MED18 | physical | 22939629 | |
MED12_HUMAN | MED12 | physical | 22939629 | |
MED16_HUMAN | MED16 | physical | 26344197 | |
MED17_HUMAN | MED17 | physical | 26344197 | |
MED27_HUMAN | MED27 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...