MED11_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MED11_HUMAN
• UniProt AC: Q9P086
• Protein Name: Mediator of RNA polymerase II transcription subunit 11
• Gene Name: MED11
• Organism: Homo sapiens (Human).
• Sequence Length: 117
• Subcellular Localization: Nucleus .
• Protein Description: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors..
• Protein Sequence: MATYSLANERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQAAAFTASVQHVEAELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVARTCEQMLEN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MATYSLANE ------CCCHHHHHH	18.42	22814378
4	Phosphorylation	----MATYSLANERL ----CCCHHHHHHHH	7.67	27642862
69	Phosphorylation	ELSAQIRYLTQVATG HHHHHHHHHHHHHCC	18.74	23532336
82	Phosphorylation	TGQPHEGSSYSSRKD CCCCCCCCCCCCHHH	24.10	23532336
84	Phosphorylation	QPHEGSSYSSRKDCQ CCCCCCCCCCHHHHH	16.62	18452278
85	Phosphorylation	PHEGSSYSSRKDCQM CCCCCCCCCHHHHHH	26.14	28555341
95	Acetylation	KDCQMALKRVDYARL HHHHHHHHHHCHHHH	40.62	25953088
103	Acetylation	RVDYARLKLSDVART HHCHHHHHHHHHHHH	40.15	25953088
103	Ubiquitination	RVDYARLKLSDVART HHCHHHHHHHHHHHH	40.15	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MED11_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MED11_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MED11_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
MED29_HUMAN	MED29	physical	22939629
MED1_HUMAN	MED1	physical	22939629
MED8_HUMAN	MED8	physical	22939629
MED21_HUMAN	MED21	physical	22939629
MED17_HUMAN	MED17	physical	22939629
MED6_HUMAN	MED6	physical	22939629
MED4_HUMAN	MED4	physical	22939629
MED24_HUMAN	MED24	physical	22939629
MED16_HUMAN	MED16	physical	22939629
MED14_HUMAN	MED14	physical	22939629
MED18_HUMAN	MED18	physical	22939629
MED12_HUMAN	MED12	physical	22939629
MED16_HUMAN	MED16	physical	26344197
MED17_HUMAN	MED17	physical	26344197
MED27_HUMAN	MED27	physical	26344197

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.