dbPTM

MED7_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MED7_HUMAN
UniProt AC	O43513
Protein Name	Mediator of RNA polymerase II transcription subunit 7
Gene Name	MED7
Organism	Homo sapiens (Human).
Sequence Length	233
Subcellular Localization	Nucleus.
Protein Description	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors..
Protein Sequence	MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
33	Ubiquitination	IQEGLAPKPPPPIKD HHHCCCCCCCCCCCC	65.63	-
155	Ubiquitination	ETAERFQKHLERVIE HHHHHHHHHHHHHHH	47.66	21890473
185	Sumoylation	SEAGMRVKTEPMDAD CCCCCCEECCCCCCC	36.48	-
185	Sumoylation	SEAGMRVKTEPMDAD CCCCCCEECCCCCCC	36.48	25114211
185	Ubiquitination	SEAGMRVKTEPMDAD CCCCCCEECCCCCCC	36.48	-
185	Acetylation	SEAGMRVKTEPMDAD CCCCCCEECCCCCCC	36.48	26051181
186	Phosphorylation	EAGMRVKTEPMDADD CCCCCEECCCCCCCC	42.33	27251275
194	Phosphorylation	EPMDADDSNNCTGQN CCCCCCCCCCCCCCC	30.41	25218447
198	Phosphorylation	ADDSNNCTGQNEHQR CCCCCCCCCCCHHHH	43.88	27251275

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MED7_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MED7_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MED7_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBAC1_HUMAN	UBAC1	physical	17353931
BARH1_HUMAN	BARHL1	physical	17353931
FXR2_HUMAN	FXR2	physical	17353931
RFOX2_HUMAN	RBFOX2	physical	20211142
TRI29_HUMAN	TRIM29	physical	20211142
MED31_HUMAN	MED31	physical	20211142
PHS2_HUMAN	PCBD2	physical	20211142
RHXF2_HUMAN	RHOXF2	physical	20211142
TRI15_HUMAN	TRIM15	physical	20211142
ZSCA1_HUMAN	ZSCAN1	physical	20211142
HAUS1_HUMAN	HAUS1	physical	25416956
MED13_HUMAN	MED13	physical	26186194
MED1_HUMAN	MED1	physical	26186194
MED27_HUMAN	MED27	physical	26186194
MED31_HUMAN	MED31	physical	26186194
MED26_HUMAN	MED26	physical	26186194
MD13L_HUMAN	MED13L	physical	26186194
MED16_HUMAN	MED16	physical	26186194
MED14_HUMAN	MED14	physical	26186194
MED12_HUMAN	MED12	physical	26186194
MD12L_HUMAN	MED12L	physical	26186194
MED21_HUMAN	MED21	physical	26186194
MED23_HUMAN	MED23	physical	26186194
MED15_HUMAN	MED15	physical	26186194
MED9_HUMAN	MED9	physical	26186194
MED6_HUMAN	MED6	physical	26186194
MED4_HUMAN	MED4	physical	26186194
MED28_HUMAN	MED28	physical	26186194
MED17_HUMAN	MED17	physical	26186194
CCNC_HUMAN	CCNC	physical	26186194
MED29_HUMAN	MED29	physical	26186194
MED22_HUMAN	MED22	physical	26186194
MED24_HUMAN	MED24	physical	26186194
MED10_HUMAN	MED10	physical	26186194
PRDC1_HUMAN	PRTFDC1	physical	26186194
MED20_HUMAN	MED20	physical	26186194
CDK19_HUMAN	CDK19	physical	26186194
CDK8_HUMAN	CDK8	physical	26186194
MED19_HUMAN	MED19	physical	26186194
MED18_HUMAN	MED18	physical	26186194
MED30_HUMAN	MED30	physical	26186194
MED8_HUMAN	MED8	physical	26186194
MED11_HUMAN	MED11	physical	26186194
MED1_HUMAN	MED1	physical	28514442
MED19_HUMAN	MED19	physical	28514442
CCNC_HUMAN	CCNC	physical	28514442
MED31_HUMAN	MED31	physical	28514442
MED6_HUMAN	MED6	physical	28514442
MED27_HUMAN	MED27	physical	28514442
MED13_HUMAN	MED13	physical	28514442
MED9_HUMAN	MED9	physical	28514442
MED22_HUMAN	MED22	physical	28514442
MED17_HUMAN	MED17	physical	28514442
MED20_HUMAN	MED20	physical	28514442
MD13L_HUMAN	MED13L	physical	28514442
MED26_HUMAN	MED26	physical	28514442
MED4_HUMAN	MED4	physical	28514442
MED14_HUMAN	MED14	physical	28514442
MED8_HUMAN	MED8	physical	28514442
MD12L_HUMAN	MED12L	physical	28514442
MED10_HUMAN	MED10	physical	28514442
MED30_HUMAN	MED30	physical	28514442
MED12_HUMAN	MED12	physical	28514442
MED28_HUMAN	MED28	physical	28514442
MED24_HUMAN	MED24	physical	28514442
CDK8_HUMAN	CDK8	physical	28514442
MED11_HUMAN	MED11	physical	28514442
MED23_HUMAN	MED23	physical	28514442
MED15_HUMAN	MED15	physical	28514442
MED16_HUMAN	MED16	physical	28514442
MED29_HUMAN	MED29	physical	28514442
CDK19_HUMAN	CDK19	physical	28514442
PRDC1_HUMAN	PRTFDC1	physical	28514442

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MED7_HUMAN

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Large-scale proteomics analysis of the human kinome."; Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G.,Mann M., Daub H.; Mol. Cell. Proteomics 8:1751-1764(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-194, AND MASSSPECTROMETRY.	19369195 [Abstract]