| UniProt ID | MED26_HUMAN | |
|---|---|---|
| UniProt AC | O95402 | |
| Protein Name | Mediator of RNA polymerase II transcription subunit 26 | |
| Gene Name | MED26 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 600 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors.. | |
| Protein Sequence | MTAAPASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQKLIEPAHQHEAALRGLAGATGSANGGAHNCRPEVGAAGPPRSIHDLKSRNDLQRLPGQRLDRLGSRKRRGDQRDLGHPGPPPKVSKASHDPLVPNSSPLPTNGISGSPESFASSLDGSGHAGPEGSRLERDENDKHSGKIPVNAVRPHTSSPGLGKPPGPCLQPKASVLQQLDRVDETPGPPHPKGPPRCSFSPRNSRHEGSFARQQSLYAPKGSVPSPSPRPQALDATQVPSPLPLAQPSTPPVRRLELLPSAESPVCWLEQPESHQRLAGPGCKAGLSPAEPLLSRAGFSPDSSKADSDAASSGGSDSKKKKRYRPRDYTVNLDGQVAEAGVKPVRLKERKLTFDPMTRQIKPLTQKEPVRADSPVHMEQQSRTELDKQEAKASLQSPFEQTNWKELSRNEIIQSYLSRQSSLLSSSGAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MTAAPASPQ ------CCCCCCCHH | 31.37 | 23186163 | |
| 7 | Phosphorylation | -MTAAPASPQQIRDR -CCCCCCCHHHHHHH | 23.37 | 23401153 | |
| 40 | Ubiquitination | EVISSLEKYPITKEA HHHHHHHHCCCCHHH | 62.71 | - | |
| 55 | Ubiquitination | LEETRLGKLINDVRK HHHHHHHHHHHHHHH | 51.27 | 29967540 | |
| 71 | Acetylation | TKNEELAKRAKKLLR HCCHHHHHHHHHHHH | 66.56 | 20167786 | |
| 169 | Phosphorylation | PPKVSKASHDPLVPN CCCCCCCCCCCCCCC | 31.96 | 23186163 | |
| 177 | Phosphorylation | HDPLVPNSSPLPTNG CCCCCCCCCCCCCCC | 27.54 | 23401153 | |
| 178 | Phosphorylation | DPLVPNSSPLPTNGI CCCCCCCCCCCCCCC | 36.78 | 25850435 | |
| 182 | Phosphorylation | PNSSPLPTNGISGSP CCCCCCCCCCCCCCH | 54.48 | 23186163 | |
| 186 | Phosphorylation | PLPTNGISGSPESFA CCCCCCCCCCHHHHH | 34.32 | 23186163 | |
| 188 | Phosphorylation | PTNGISGSPESFASS CCCCCCCCHHHHHHH | 20.78 | 25850435 | |
| 191 | Phosphorylation | GISGSPESFASSLDG CCCCCHHHHHHHCCC | 29.51 | 28464451 | |
| 194 | Phosphorylation | GSPESFASSLDGSGH CCHHHHHHHCCCCCC | 29.44 | 23186163 | |
| 195 | Phosphorylation | SPESFASSLDGSGHA CHHHHHHHCCCCCCC | 27.35 | 23186163 | |
| 230 | Phosphorylation | VNAVRPHTSSPGLGK CCEECCCCCCCCCCC | 33.32 | 28152594 | |
| 231 | Phosphorylation | NAVRPHTSSPGLGKP CEECCCCCCCCCCCC | 31.34 | 28152594 | |
| 232 | Phosphorylation | AVRPHTSSPGLGKPP EECCCCCCCCCCCCC | 24.92 | 25159151 | |
| 259 | Phosphorylation | QLDRVDETPGPPHPK HHHCCCCCCCCCCCC | 29.14 | 28555341 | |
| 272 | Phosphorylation | PKGPPRCSFSPRNSR CCCCCCCCCCCCCCC | 30.00 | 21712546 | |
| 274 | Phosphorylation | GPPRCSFSPRNSRHE CCCCCCCCCCCCCCC | 13.47 | 30576142 | |
| 289 | Phosphorylation | GSFARQQSLYAPKGS CCCCCCCCCCCCCCC | 18.27 | 23312004 | |
| 291 | Phosphorylation | FARQQSLYAPKGSVP CCCCCCCCCCCCCCC | 26.55 | 27080861 | |
| 296 | Phosphorylation | SLYAPKGSVPSPSPR CCCCCCCCCCCCCCC | 36.66 | 23927012 | |
| 299 | Phosphorylation | APKGSVPSPSPRPQA CCCCCCCCCCCCCCC | 35.54 | 23927012 | |
| 301 | Phosphorylation | KGSVPSPSPRPQALD CCCCCCCCCCCCCCC | 37.57 | 30266825 | |
| 310 | Phosphorylation | RPQALDATQVPSPLP CCCCCCCCCCCCCCC | 29.75 | 30266825 | |
| 314 | Phosphorylation | LDATQVPSPLPLAQP CCCCCCCCCCCCCCC | 39.97 | 30266825 | |
| 322 | Phosphorylation | PLPLAQPSTPPVRRL CCCCCCCCCCCEEEE | 41.27 | 30266825 | |
| 323 | Phosphorylation | LPLAQPSTPPVRRLE CCCCCCCCCCEEEEE | 37.99 | 30266825 | |
| 334 | Phosphorylation | RRLELLPSAESPVCW EEEEECCCCCCCEEE | 44.64 | 28450419 | |
| 337 | Phosphorylation | ELLPSAESPVCWLEQ EECCCCCCCEEECCC | 23.50 | 25159151 | |
| 361 | Phosphorylation | PGCKAGLSPAEPLLS CCCCCCCCCCHHHHH | 22.58 | 25159151 | |
| 368 | Phosphorylation | SPAEPLLSRAGFSPD CCCHHHHHHCCCCCC | 27.97 | 23663014 | |
| 373 | Phosphorylation | LLSRAGFSPDSSKAD HHHHCCCCCCCHHHC | 27.21 | 29255136 | |
| 376 | Phosphorylation | RAGFSPDSSKADSDA HCCCCCCCHHHCHHH | 36.80 | 30108239 | |
| 377 | Phosphorylation | AGFSPDSSKADSDAA CCCCCCCHHHCHHHH | 38.96 | 25159151 | |
| 381 | Phosphorylation | PDSSKADSDAASSGG CCCHHHCHHHHHCCC | 33.73 | 28450419 | |
| 385 | Phosphorylation | KADSDAASSGGSDSK HHCHHHHHCCCCCCC | 31.10 | 28450419 | |
| 386 | Phosphorylation | ADSDAASSGGSDSKK HCHHHHHCCCCCCCC | 42.31 | 23403867 | |
| 389 | Phosphorylation | DAASSGGSDSKKKKR HHHHCCCCCCCCCCC | 42.09 | 23403867 | |
| 391 | Phosphorylation | ASSGGSDSKKKKRYR HHCCCCCCCCCCCCC | 48.34 | 23403867 | |
| 416 | Acetylation | QVAEAGVKPVRLKER HHHCCCCCCEECCCC | 36.56 | 25953088 | |
| 426 | Phosphorylation | RLKERKLTFDPMTRQ ECCCCCCCCCCCCCC | 29.09 | 30576142 | |
| 431 | Phosphorylation | KLTFDPMTRQIKPLT CCCCCCCCCCCCCCC | 25.47 | 27732954 | |
| 438 | Phosphorylation | TRQIKPLTQKEPVRA CCCCCCCCCCCCCCC | 46.23 | 23403867 | |
| 447 | Phosphorylation | KEPVRADSPVHMEQQ CCCCCCCCCCCHHHH | 28.04 | 29255136 | |
| 455 | Phosphorylation | PVHMEQQSRTELDKQ CCCHHHHCCHHHHHH | 40.64 | 30266825 | |
| 467 | Phosphorylation | DKQEAKASLQSPFEQ HHHHHHHHCCCHHHH | 26.66 | 28985074 | |
| 470 | Phosphorylation | EAKASLQSPFEQTNW HHHHHCCCHHHHCCH | 36.53 | 25159151 | |
| 475 | Phosphorylation | LQSPFEQTNWKELSR CCCHHHHCCHHHHHH | 35.53 | 26552605 | |
| 481 | Phosphorylation | QTNWKELSRNEIIQS HCCHHHHHHHHHHHH | 33.86 | 28555341 | |
| 488 | Phosphorylation | SRNEIIQSYLSRQSS HHHHHHHHHHHHHHH | 20.03 | 28634298 | |
| 489 | Phosphorylation | RNEIIQSYLSRQSSL HHHHHHHHHHHHHHH | 7.72 | 28634298 | |
| 491 | Phosphorylation | EIIQSYLSRQSSLLS HHHHHHHHHHHHHHH | 21.75 | 28555341 | |
| 494 | Phosphorylation | QSYLSRQSSLLSSSG HHHHHHHHHHHHCCC | 23.11 | 27251275 | |
| 495 | Phosphorylation | SYLSRQSSLLSSSGA HHHHHHHHHHHCCCC | 25.62 | 22210691 | |
| 498 | Phosphorylation | SRQSSLLSSSGAQTP HHHHHHHHCCCCCCC | 27.96 | 28348404 | |
| 499 | Phosphorylation | RQSSLLSSSGAQTPG HHHHHHHCCCCCCCC | 32.53 | 22210691 | |
| 500 | Phosphorylation | QSSLLSSSGAQTPGA HHHHHHCCCCCCCCH | 34.47 | 28348404 | |
| 504 | Phosphorylation | LSSSGAQTPGAHHFM HHCCCCCCCCHHHHH | 24.13 | 22210691 | |
| 512 | Phosphorylation | PGAHHFMSEYLKQEE CCHHHHHHHHHHHHH | 23.34 | 28348404 | |
| 535 | Phosphorylation | LHVLVPQSPPTDLPG EEEECCCCCCCCCCC | 27.12 | 23401153 | |
| 538 | Phosphorylation | LVPQSPPTDLPGLTR ECCCCCCCCCCCCCE | 54.26 | 30266825 | |
| 544 | Phosphorylation | PTDLPGLTREVTQDD CCCCCCCCEEECHHH | 30.60 | 30266825 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MED26_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MED26_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MED26_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-314 AND SER-361, ANDMASS SPECTROMETRY. | |
| "A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-361, AND MASSSPECTROMETRY. | |
| "Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-337 AND SER-447, ANDMASS SPECTROMETRY. | |
