| UniProt ID | TAF13_HUMAN | |
|---|---|---|
| UniProt AC | Q15543 | |
| Protein Name | Transcription initiation factor TFIID subunit 13 {ECO:0000305} | |
| Gene Name | TAF13 {ECO:0000312|HGNC:HGNC:11546} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 124 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of the DNA-binding general RNA polymerase II transcription factor IID complex (TFIID). TFIID plays a critical role in the regulation of gene transcription in eukaryotic cells.. | |
| Protein Sequence | MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Phosphorylation | ADEEEDPTFEEENEE CCCCCCCCCHHHCCC | 56.87 | - | |
| 33 | Phosphorylation | GKRKRLFSKELRCMM CHHHHHHCHHHHHHH | 29.79 | 17001009 | |
| 34 | Ubiquitination | KRKRLFSKELRCMMY HHHHHHCHHHHHHHH | 54.13 | - | |
| 101 | Ubiquitination | PRKFARVKDLLTMNE HHHHHHHHHHHCCCH | 36.79 | - | |
| 111 | Ubiquitination | LTMNEELKRARKAFD HCCCHHHHHHHHHHH | 47.49 | 21906983 | |
| 115 | Ubiquitination | EELKRARKAFDEANY HHHHHHHHHHHHHHC | 53.04 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TAF13_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TAF13_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TAF13_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TBP_HUMAN | TBP | physical | 7729427 | |
| TAF10_HUMAN | TAF10 | physical | 7729427 | |
| TAF4_HUMAN | TAF4 | physical | 17643375 | |
| TAF5_HUMAN | TAF5 | physical | 17643375 | |
| TAF6_HUMAN | TAF6 | physical | 17643375 | |
| TAF1_HUMAN | TAF1 | physical | 17643375 | |
| TAF7L_HUMAN | TAF7L | physical | 17643375 | |
| PARP1_HUMAN | PARP1 | physical | 17643375 | |
| TAF2_HUMAN | TAF2 | physical | 17643375 | |
| PFKAL_HUMAN | PFKL | physical | 17643375 | |
| SMRC2_HUMAN | SMARCC2 | physical | 17643375 | |
| RPA1_HUMAN | POLR1A | physical | 17643375 | |
| TAF9B_HUMAN | TAF9B | physical | 17643375 | |
| TAF9_HUMAN | TAF9 | physical | 17643375 | |
| TBP_HUMAN | TBP | physical | 22939629 | |
| TAF5_HUMAN | TAF5 | physical | 22939629 | |
| TAF4_HUMAN | TAF4 | physical | 22939629 | |
| TAF9_HUMAN | TAF9 | physical | 22939629 | |
| MTUS2_HUMAN | MTUS2 | physical | 25416956 | |
| TAF11_HUMAN | TAF11 | physical | 29111974 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
