UniProt ID | TAF13_HUMAN | |
---|---|---|
UniProt AC | Q15543 | |
Protein Name | Transcription initiation factor TFIID subunit 13 {ECO:0000305} | |
Gene Name | TAF13 {ECO:0000312|HGNC:HGNC:11546} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 124 | |
Subcellular Localization | Nucleus . | |
Protein Description | Component of the DNA-binding general RNA polymerase II transcription factor IID complex (TFIID). TFIID plays a critical role in the regulation of gene transcription in eukaryotic cells.. | |
Protein Sequence | MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | ADEEEDPTFEEENEE CCCCCCCCCHHHCCC | 56.87 | - | |
33 | Phosphorylation | GKRKRLFSKELRCMM CHHHHHHCHHHHHHH | 29.79 | 17001009 | |
34 | Ubiquitination | KRKRLFSKELRCMMY HHHHHHCHHHHHHHH | 54.13 | - | |
101 | Ubiquitination | PRKFARVKDLLTMNE HHHHHHHHHHHCCCH | 36.79 | - | |
111 | Ubiquitination | LTMNEELKRARKAFD HCCCHHHHHHHHHHH | 47.49 | 21906983 | |
115 | Ubiquitination | EELKRARKAFDEANY HHHHHHHHHHHHHHC | 53.04 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TAF13_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TAF13_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TAF13_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TBP_HUMAN | TBP | physical | 7729427 | |
TAF10_HUMAN | TAF10 | physical | 7729427 | |
TAF4_HUMAN | TAF4 | physical | 17643375 | |
TAF5_HUMAN | TAF5 | physical | 17643375 | |
TAF6_HUMAN | TAF6 | physical | 17643375 | |
TAF1_HUMAN | TAF1 | physical | 17643375 | |
TAF7L_HUMAN | TAF7L | physical | 17643375 | |
PARP1_HUMAN | PARP1 | physical | 17643375 | |
TAF2_HUMAN | TAF2 | physical | 17643375 | |
PFKAL_HUMAN | PFKL | physical | 17643375 | |
SMRC2_HUMAN | SMARCC2 | physical | 17643375 | |
RPA1_HUMAN | POLR1A | physical | 17643375 | |
TAF9B_HUMAN | TAF9B | physical | 17643375 | |
TAF9_HUMAN | TAF9 | physical | 17643375 | |
TBP_HUMAN | TBP | physical | 22939629 | |
TAF5_HUMAN | TAF5 | physical | 22939629 | |
TAF4_HUMAN | TAF4 | physical | 22939629 | |
TAF9_HUMAN | TAF9 | physical | 22939629 | |
MTUS2_HUMAN | MTUS2 | physical | 25416956 | |
TAF11_HUMAN | TAF11 | physical | 29111974 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...