UniProt ID | TAF10_HUMAN | |
---|---|---|
UniProt AC | Q12962 | |
Protein Name | Transcription initiation factor TFIID subunit 10 | |
Gene Name | TAF10 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 218 | |
Subcellular Localization | Nucleus . | |
Protein Description | TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC). TIIFD is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors.. | |
Protein Sequence | MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGEPAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSCSGSGAD ------CCCCCCCCC | 19.59 | 28348404 | |
2 | Acetylation | ------MSCSGSGAD ------CCCCCCCCC | 19.59 | 19413330 | |
4 | Phosphorylation | ----MSCSGSGADPE ----CCCCCCCCCCC | 28.78 | 28348404 | |
6 | Phosphorylation | --MSCSGSGADPEAA --CCCCCCCCCCCCC | 17.95 | 28348404 | |
16 | Phosphorylation | DPEAAPASAASAPGP CCCCCCCHHHCCCCC | 24.25 | 28348404 | |
19 | Phosphorylation | AAPASAASAPGPAPP CCCCHHHCCCCCCCC | 34.41 | 28348404 | |
35 | Phosphorylation | SAPAALPSSTAAENK CCCCCCCCCHHHHHC | 40.97 | 28348404 | |
36 | Phosphorylation | APAALPSSTAAENKA CCCCCCCCHHHHHCC | 21.81 | 28348404 | |
37 | Phosphorylation | PAALPSSTAAENKAS CCCCCCCHHHHHCCC | 33.94 | 28985074 | |
44 | Phosphorylation | TAAENKASPAGTAGG HHHHHCCCCCCCCCC | 19.52 | 30266825 | |
48 | Phosphorylation | NKASPAGTAGGPGAG HCCCCCCCCCCCCCC | 25.00 | 30266825 | |
61 | Phosphorylation | AGAAAGGTGPLAARA CCCCCCCCCCCHHHC | 34.41 | 29396449 | |
67 | Methylation | GTGPLAARAGEPAER CCCCCHHHCCCCHHH | 37.20 | 115918105 | |
147 | Phosphorylation | NRAGFEASDPRIIRL HHCCCCCCCHHHHHH | 40.73 | 20068231 | |
161 | Ubiquitination | LISLAAQKFISDIAN HHHHHHHHHHHHHHH | 39.68 | - | |
175 | Ubiquitination | NDALQHCKMKGTASG HHHHHHHHHCCCCCC | 41.33 | 32015554 | |
175 | Acetylation | NDALQHCKMKGTASG HHHHHHHHHCCCCCC | 41.33 | 25953088 | |
177 | Ubiquitination | ALQHCKMKGTASGSS HHHHHHHCCCCCCCC | 38.31 | - | |
186 | Phosphorylation | TASGSSRSKSKDRKY CCCCCCCCCCCCCCE | 43.14 | - | |
187 | Acetylation | ASGSSRSKSKDRKYT CCCCCCCCCCCCCEE | 61.49 | 7975571 | |
189 | Trimethylation | GSSRSKSKDRKYTLT CCCCCCCCCCCEEEE | 66.35 | - | |
189 | Methylation | GSSRSKSKDRKYTLT CCCCCCCCCCCEEEE | 66.35 | 25959397 | |
189 | Deamination | GSSRSKSKDRKYTLT CCCCCCCCCCCEEEE | 66.35 | 25959397 | |
191 | Methylation | SRSKSKDRKYTLTME CCCCCCCCCEEEEHH | 37.30 | - | |
201 | Phosphorylation | TLTMEDLTPALSEYG EEEHHHHHHHHHHHC | 20.88 | 29083192 | |
205 | Phosphorylation | EDLTPALSEYGINVK HHHHHHHHHHCCCCC | 30.77 | 29083192 | |
207 | Phosphorylation | LTPALSEYGINVKKP HHHHHHHHCCCCCCC | 21.67 | 29083192 | |
212 | Ubiquitination | SEYGINVKKPHYFT- HHHCCCCCCCCCCC- | 56.98 | 29967540 | |
216 | Phosphorylation | INVKKPHYFT----- CCCCCCCCCC----- | 19.90 | 27642862 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TAF10_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
189 | K | Methylation |
| 15099517 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TAF10_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Methylation | |
Reference | PubMed |
"Structural basis for the methylation site specificity of SET7/9."; Couture J.-F., Collazo E., Hauk G., Trievel R.C.; Nat. Struct. Mol. Biol. 13:140-146(2006). Cited for: MOTIF, AND METHYLATION AT LYS-189. | |
"Gene-specific modulation of TAF10 function by SET9-mediatedmethylation."; Kouskouti A., Scheer E., Staub A., Tora L., Talianidis I.; Mol. Cell 14:175-182(2004). Cited for: METHYLATION AT LYS-189, AND MUTAGENESIS OF LYS-189. |