| UniProt ID | ERCC1_HUMAN | |
|---|---|---|
| UniProt AC | P07992 | |
| Protein Name | DNA excision repair protein ERCC-1 | |
| Gene Name | ERCC1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 297 | |
| Subcellular Localization |
Isoform 1: Nucleus. Isoform 2: Cytoplasm. Nucleus. Isoform 3: Nucleus. Isoform 4: Nucleus. |
|
| Protein Description | Isoform 1: Non-catalytic component of a structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair. Responsible, in conjunction with SLX4, for the first step in the repair of interstrand cross-links (ICL). Participates in the processing of anaphase bridge-generating DNA structures, which consist in incompletely processed DNA lesions arising during S or G2 phase, and can result in cytokinesis failure. Also required for homology-directed repair (HDR) of DNA double-strand breaks, in conjunction with SLX4.. | |
| Protein Sequence | MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MDPGKDKE -------CCCCCCCC | 14.66 | 22814378 | |
| 14 | Phosphorylation | KEGVPQPSGPPARKK CCCCCCCCCCCCCCC | 59.70 | - | |
| 21 | Sumoylation | SGPPARKKFVIPLDE CCCCCCCCEEEECCC | 39.03 | 28112733 | |
| 21 | Ubiquitination | SGPPARKKFVIPLDE CCCCCCCCEEEECCC | 39.03 | - | |
| 37 | Acetylation | EVPPGVAKPLFRSTQ CCCCCCCHHHCCCCC | 39.59 | 23954790 | |
| 37 | Sumoylation | EVPPGVAKPLFRSTQ CCCCCCCHHHCCCCC | 39.59 | 28112733 | |
| 37 | Ubiquitination | EVPPGVAKPLFRSTQ CCCCCCCHHHCCCCC | 39.59 | - | |
| 42 | Ubiquitination | VAKPLFRSTQSLPTV CCHHHCCCCCCCCCC | 24.38 | - | |
| 90 | Ubiquitination | LAGETPNQALKPGAK CCCCCCCCCCCCCCC | 49.64 | 21890473 | |
| 100 | Phosphorylation | KPGAKSNSIIVSPRQ CCCCCCCCEEECCHH | 22.30 | 28857561 | |
| 104 | Phosphorylation | KSNSIIVSPRQRGNP CCCCEEECCHHCCCC | 12.17 | 23403867 | |
| 104 | Ubiquitination | KSNSIIVSPRQRGNP CCCCEEECCHHCCCC | 12.17 | - | |
| 114 | Ubiquitination | QRGNPVLKFVRNVPW HCCCCCHHHHHCCCC | 41.89 | - | |
| 141 | Ubiquitination | QSTCALFLSLRYHNL HHHHHHHHHHHHHCC | 4.98 | - | |
| 154 | Ubiquitination | NLHPDYIHGRLQSLG CCCHHHHHHHHHHCC | 14.75 | - | |
| 162 | Ubiquitination | GRLQSLGKNFALRVL HHHHHCCCCHHHEEE | 54.94 | 21890473 | |
| 162 | Ubiquitination | GRLQSLGKNFALRVL HHHHHCCCCHHHEEE | 54.94 | 21890473 | |
| 162 | Ubiquitination | GRLQSLGKNFALRVL HHHHHCCCCHHHEEE | 54.94 | 21890473 | |
| 162 (in isoform 3) | Ubiquitination | - | 54.94 | - | |
| 162 | Ubiquitination | GRLQSLGKNFALRVL HHHHHCCCCHHHEEE | 54.94 | 2189047 | |
| 171 | Ubiquitination | FALRVLLVQVDVKDP HHHEEEEEECCCCCH | 4.57 | - | |
| 176 | Ubiquitination | LLVQVDVKDPQQALK EEEECCCCCHHHHHH | 60.26 | - | |
| 209 | Ubiquitination | PEEAGRYLETYKAYE HHHHHHHHHHHHHHH | 3.69 | - | |
| 213 | Ubiquitination | GRYLETYKAYEQKPA HHHHHHHHHHHCCHH | 52.49 | - | |
| 223 | Ubiquitination | EQKPADLLMEKLEQD HCCHHHHHHHHHHHH | 4.25 | 21890473 | |
| 226 | Ubiquitination | PADLLMEKLEQDFVS HHHHHHHHHHHHHHH | 43.27 | - | |
| 243 | Acetylation | TECLTTVKSVNKTDS HHHHHHHHCCCCCCC | 46.74 | 25953088 | |
| 243 | Sumoylation | TECLTTVKSVNKTDS HHHHHHHHCCCCCCC | 46.74 | 28112733 | |
| 243 | Ubiquitination | TECLTTVKSVNKTDS HHHHHHHHCCCCCCC | 46.74 | - | |
| 247 | Ubiquitination | TTVKSVNKTDSQTLL HHHHCCCCCCCHHHH | 52.10 | - | |
| 256 | Phosphorylation | DSQTLLTTFGSLEQL CCHHHHHHHHCHHHH | 26.43 | 28348404 | |
| 259 | Phosphorylation | TLLTTFGSLEQLIAA HHHHHHHCHHHHHHH | 25.25 | 28348404 | |
| 281 | Ubiquitination | CPGLGPQKARRLFDV CCCCCHHHHHHHHHH | 47.17 | - | |
| 295 | Ubiquitination | VLHEPFLKVP----- HHHCCCCCCC----- | 53.49 | 21890473 | |
| 295 | Acetylation | VLHEPFLKVP----- HHHCCCCCCC----- | 53.49 | 30588563 | |
| 307 (in isoform 3) | Phosphorylation | - | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ERCC1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ERCC1_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 610758 | Cerebro-oculo-facio-skeletal syndrome 4 (COFS4) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
