UniProt ID | CO040_HUMAN | |
---|---|---|
UniProt AC | Q8WUR7 | |
Protein Name | UPF0235 protein C15orf40 | |
Gene Name | C15orf40 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 153 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MLRLRSGLRHLRATPNTRGSARLLCAEMPKKAGATTKGKSQSKEPERPLPPLGPVAVDPKGCVTIAIHAKPGSKQNAVTDLTAEAVNVAIAAPPSEGEANAELCRYLSKVLELRKSDVVLDKGGKSREKVVKLLASTTPEEILEKLKKEAKKT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | O-linked_Glycosylation | --MLRLRSGLRHLRA --CCCCCCCCCHHCC | 32.13 | 30379171 | |
14 | O-linked_Glycosylation | GLRHLRATPNTRGSA CCCHHCCCCCCCHHH | 63.11 | 30379171 | |
14 | Phosphorylation | GLRHLRATPNTRGSA CCCHHCCCCCCCHHH | 63.11 | 25954137 | |
17 | O-linked_Glycosylation | HLRATPNTRGSARLL HHCCCCCCCHHHHHE | 58.61 | 30379171 | |
30 | Acetylation | LLCAEMPKKAGATTK HEEECCCHHCCCCCC | 15.31 | 25953088 | |
35 | Phosphorylation | MPKKAGATTKGKSQS CCHHCCCCCCCCCCC | 2.81 | 20068231 | |
36 | Phosphorylation | PKKAGATTKGKSQSK CHHCCCCCCCCCCCC | 6.22 | 20068231 | |
40 | Phosphorylation | GATTKGKSQSKEPER CCCCCCCCCCCCCCC | 2.61 | 24719451 | |
89 | Phosphorylation | TAEAVNVAIAAPPSE HHHHHHEEEECCCCC | 29.24 | 18669648 | |
106 | Phosphorylation | ANAELCRYLSKVLEL HHHHHHHHHHHHHHH | 3.06 | 20068231 | |
108 | Phosphorylation | AELCRYLSKVLELRK HHHHHHHHHHHHHHH | 18.44 | 20068231 | |
109 | Ubiquitination | ELCRYLSKVLELRKS HHHHHHHHHHHHHHH | 32.55 | 21890473 | |
116 | Phosphorylation | KVLELRKSDVVLDKG HHHHHHHHCEEEECC | 5.55 | 25159151 | |
122 | Ubiquitination | KSDVVLDKGGKSREK HHCEEEECCCCCHHH | 65.22 | 24816145 | |
132 | Ubiquitination | KSREKVVKLLASTTP CCHHHHHHHHHCCCH | 29967540 | ||
145 | Ubiquitination | TPEEILEKLKKEAKK CHHHHHHHHHHHHHC | 29967540 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CO040_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CO040_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CO040_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CO040_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-89, AND MASSSPECTROMETRY. |