VP37B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VP37B_HUMAN
• UniProt AC: Q9H9H4
• Protein Name: Vacuolar protein sorting-associated protein 37B
• Gene Name: VPS37B
• Organism: Homo sapiens (Human).
• Sequence Length: 285
• Subcellular Localization: Late endosome membrane ; Peripheral membrane protein . Recruited to the endosomal membrane in a VPS4A-dependent fashion.
• Protein Description: Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. May be involved in cell growth and differentiation..
• Protein Sequence: MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNLLYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRLPELAPTAPLPYPAPEASGPPAVAPRRIPPPPPPVPAGRLATPFTAAMSSGQAVPYPGLQCPPLPPRVGLPTQQGFSSQFVSPYPPPLPQRPPPRLPPHQPGFILQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
35	Sulfoxidation	LTEMVQKMEETQNVQ HHHHHHHHHHHCCCC	2.92	21406390
45	Ubiquitination	TQNVQLNKEMTLASN HCCCCCCHHHHHHHC	58.41	21906983
70	Ubiquitination	QPQLDTLKARLTQKY CCCHHHHHHHHHHHH	33.29	21906983
98	Phosphorylation	KTKLDRQSSSASLET CCCCHHHCCHHHHHH	27.44	28450419
99	Phosphorylation	TKLDRQSSSASLETL CCCHHHCCHHHHHHH	22.91	28450419
100	Phosphorylation	KLDRQSSSASLETLL CCHHHCCHHHHHHHH	27.42	26657352
102	Phosphorylation	DRQSSSASLETLLAL HHHCCHHHHHHHHHH	28.78	26657352
105	Phosphorylation	SSSASLETLLALLQA CCHHHHHHHHHHHHH	32.15	28450419
145	Ubiquitination	FIDVYQSKRKLAHMR HHHHHHHHHHHHHHH	37.72	21906983
145	Acetylation	FIDVYQSKRKLAHMR HHHHHHHHHHHHHHH	37.72	22361631
162	Sulfoxidation	KIEKLQEMVLKGQRL HHHHHHHHHHCCCCC	2.49	21406390
165	Ubiquitination	KLQEMVLKGQRLPQA HHHHHHHCCCCCCHH	41.40	-
191	Phosphorylation	APTAPLPYPAPEASG CCCCCCCCCCCCCCC	21.51	27470641
197	Phosphorylation	PYPAPEASGPPAVAP CCCCCCCCCCCCCCC	50.61	27470641
218	Methylation	PPPVPAGRLATPFTA CCCCCCCCCCCCCHH	24.21	24129315
256	Phosphorylation	LPTQQGFSSQFVSPY CCCCCCCCCCCCCCC	30.01	28152594
257	Phosphorylation	PTQQGFSSQFVSPYP CCCCCCCCCCCCCCC	25.94	28152594
261	Phosphorylation	GFSSQFVSPYPPPLP CCCCCCCCCCCCCCC	21.72	28152594
263	Phosphorylation	SSQFVSPYPPPLPQR CCCCCCCCCCCCCCC	22.36	28152594

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VP37B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VP37B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VP37B_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TS101_HUMAN	TSG101	physical	15240819
TS101_HUMAN	TSG101	physical	15218037
VPS28_HUMAN	VPS28	physical	15218037
WDR12_HUMAN	WDR12	physical	22939629
XPO7_HUMAN	XPO7	physical	22939629
XPO1_HUMAN	XPO1	physical	22939629
UBS3B_HUMAN	UBASH3B	physical	25416956
FBF1_HUMAN	FBF1	physical	25416956
DNJB1_HUMAN	DNAJB1	physical	26344197
NIF3L_HUMAN	NIF3L1	physical	26344197
SH3K1_HUMAN	SH3KBP1	physical	26344197
VPS28_HUMAN	VPS28	physical	26344197
SYWC_HUMAN	WARS	physical	26344197

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.