| UniProt ID | RPAB4_HUMAN | |
|---|---|---|
| UniProt AC | P53803 | |
| Protein Name | DNA-directed RNA polymerases I, II, and III subunit RPABC4 | |
| Gene Name | POLR2K | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 58 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively.. | |
| Protein Sequence | MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Ubiquitination | ---MDTQKDVQPPKQ ---CCCCCCCCCCCC | 63.06 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RPAB4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RPAB4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RPAB4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RPB1_HUMAN | POLR2A | physical | 9201987 | |
| RPB2_HUMAN | POLR2B | physical | 9201987 | |
| RPB3_HUMAN | POLR2C | physical | 9201987 | |
| RPAB1_HUMAN | POLR2E | physical | 9201987 | |
| RPAB2_HUMAN | POLR2F | physical | 9201987 | |
| RPB7_HUMAN | POLR2G | physical | 9201987 | |
| RPAB3_HUMAN | POLR2H | physical | 9201987 | |
| RPAB4_HUMAN | POLR2K | physical | 9201987 | |
| RPB11_HUMAN | POLR2J | physical | 9201987 | |
| A4_HUMAN | APP | physical | 21832049 | |
| ESR1_HUMAN | ESR1 | physical | 16957778 | |
| SRC_HUMAN | SRC | physical | 16957778 | |
| PSB9_HUMAN | PSMB9 | physical | 16957778 | |
| ELOA1_HUMAN | TCEB3 | physical | 16957778 | |
| RPAC1_HUMAN | POLR1C | physical | 26344197 | |
| RPB1_HUMAN | POLR2A | physical | 26344197 | |
| RPAB3_HUMAN | POLR2H | physical | 26344197 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
