RPAB2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RPAB2_HUMAN
• UniProt AC: P61218
• Protein Name: DNA-directed RNA polymerases I, II, and III subunit RPABC2
• Gene Name: POLR2F
• Organism: Homo sapiens (Human).
• Sequence Length: 127
• Subcellular Localization: Nucleus .
• Protein Description: DNA-dependent RNA polymerases catalyze the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II, and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2F/RPB6 is part of the clamp element and together with parts of RPB1 and RPB2 forms a pocket to which the RPB4-RPB7 subcomplex binds (By similarity)..
• Protein Sequence: MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSDNEDNFD ------CCCCCCCCC	49.49	20068231
2	Phosphorylation	------MSDNEDNFD ------CCCCCCCCC	49.49	20363803
41	Phosphorylation	ENVEILPSGERPQAN HCEEECCCCCCCCCC	50.25	20068231
54	Phosphorylation	ANQKRITTPYMTKYE CCCCCCCCCCCCHHH	15.28	28555341
59	Ubiquitination	ITTPYMTKYERARVL CCCCCCCHHHHHHHH	28.69	21890473
101	Ubiquitination	MKELKARKIPIIIRR HHHHHHCCCCEEEEE	58.66	21890473
101	2-Hydroxyisobutyrylation	MKELKARKIPIIIRR HHHHHHCCCCEEEEE	58.66	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
2	S	Phosphorylation	Kinase	CK2-FAMILY	-	GPS
2	S	Phosphorylation	Kinase	CK2	-	Uniprot
2	S	Phosphorylation	Kinase	CK2_GROUP	-	PhosphoELM

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RPAB2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RPAB2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RPAB1_HUMAN	POLR2E	physical	9201987
RPB3_HUMAN	POLR2C	physical	9201987
A4_HUMAN	APP	physical	21832049
ESR1_HUMAN	ESR1	physical	16957778
SRC_HUMAN	SRC	physical	16957778
PSB9_HUMAN	PSMB9	physical	16957778
ELOA1_HUMAN	TCEB3	physical	16957778
RPC9_HUMAN	CRCP	physical	26344197
RPA1_HUMAN	POLR1A	physical	26344197
RPAC1_HUMAN	POLR1C	physical	26344197
RPAB3_HUMAN	POLR2H	physical	26344197
RPB9_HUMAN	POLR2I	physical	26344197
RPAB4_HUMAN	POLR2K	physical	26344197
RPC6_HUMAN	POLR3F	physical	26344197
RPC10_HUMAN	POLR3K	physical	26344197
SPT4H_HUMAN	SUPT4H1	physical	26344197
SPT5H_HUMAN	SUPT5H	physical	26344197
RPC4_HUMAN	POLR3D	physical	26496610
TF2B_HUMAN	GTF2B	physical	26496610
T2FA_HUMAN	GTF2F1	physical	26496610
T2FB_HUMAN	GTF2F2	physical	26496610
TF3C1_HUMAN	GTF3C1	physical	26496610
I15RA_HUMAN	IL15RA	physical	26496610
M3K4_HUMAN	MAP3K4	physical	26496610
RPB1_HUMAN	POLR2A	physical	26496610
RPB2_HUMAN	POLR2B	physical	26496610
RPB3_HUMAN	POLR2C	physical	26496610
RPAB1_HUMAN	POLR2E	physical	26496610
RPB7_HUMAN	POLR2G	physical	26496610
RPAB3_HUMAN	POLR2H	physical	26496610
RPB9_HUMAN	POLR2I	physical	26496610
RPB11_HUMAN	POLR2J	physical	26496610
MED1_HUMAN	MED1	physical	26496610
SDC2_HUMAN	SDC2	physical	26496610
SPT5H_HUMAN	SUPT5H	physical	26496610
CTDP1_HUMAN	CTDP1	physical	26496610
RECQ5_HUMAN	RECQL5	physical	26496610
BAG5_HUMAN	BAG5	physical	26496610
RPAC1_HUMAN	POLR1C	physical	26496610
KEAP1_HUMAN	KEAP1	physical	26496610
RPC6_HUMAN	POLR3F	physical	26496610
RPC7_HUMAN	POLR3G	physical	26496610
RPC3_HUMAN	POLR3C	physical	26496610
RPA34_HUMAN	CD3EAP	physical	26496610
TARA_HUMAN	TRIOBP	physical	26496610
RPC1_HUMAN	POLR3A	physical	26496610
GPN1_HUMAN	GPN1	physical	26496610
MAST3_HUMAN	MAST3	physical	26496610
SETX_HUMAN	SETX	physical	26496610
PKHM2_HUMAN	PLEKHM2	physical	26496610
RPA1_HUMAN	POLR1A	physical	26496610
DCAF4_HUMAN	DCAF4	physical	26496610
RPC9_HUMAN	CRCP	physical	26496610
RPA12_HUMAN	ZNRD1	physical	26496610
GPN3_HUMAN	GPN3	physical	26496610
MED15_HUMAN	MED15	physical	26496610
DC2L1_HUMAN	DYNC2LI1	physical	26496610
RPC10_HUMAN	POLR3K	physical	26496610
RPC2_HUMAN	POLR3B	physical	26496610
RPC5_HUMAN	POLR3E	physical	26496610
BDP1_HUMAN	BDP1	physical	26496610
KDM3A_HUMAN	KDM3A	physical	26496610
RPA49_HUMAN	POLR1E	physical	26496610
RPAP2_HUMAN	RPAP2	physical	26496610
MED25_HUMAN	MED25	physical	26496610
RPA2_HUMAN	POLR1B	physical	26496610
RPC7L_HUMAN	POLR3GL	physical	26496610
TDIF1_HUMAN	DNTTIP1	physical	26496610
RPC8_HUMAN	POLR3H	physical	26496610

Drug and Disease Associations

• Kegg Disease
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.