UniProt ID | RPC9_HUMAN | |
---|---|---|
UniProt AC | O75575 | |
Protein Name | DNA-directed RNA polymerase III subunit RPC9 | |
Gene Name | CRCP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 148 | |
Subcellular Localization |
Nucleus. Cell membrane Peripheral membrane protein Cytoplasmic side. |
|
Protein Description | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts induce type I interferon and NF- Kappa-B through the RIG-I pathway (By similarity).; Accessory protein for the calcitonin gene-related peptide (CGRP) receptor. It modulates CGRP responsiveness in a variety of tissues.. | |
Protein Sequence | MEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Phosphorylation | NSALLSNYEVFQLLT HHHHHHHHHHHHHHH | 15.30 | 29116813 | |
21 | Phosphorylation | YEVFQLLTDLKEQRK HHHHHHHHHHHHHHH | 48.13 | 29116813 | |
24 | Ubiquitination | FQLLTDLKEQRKESG HHHHHHHHHHHHHHC | 55.39 | - | |
34 | Ubiquitination | RKESGKNKHSSGQQN HHHHCCCCCCCCCCC | 48.64 | - | |
34 | Malonylation | RKESGKNKHSSGQQN HHHHCCCCCCCCCCC | 48.64 | 26320211 | |
34 | Acetylation | RKESGKNKHSSGQQN HHHHCCCCCCCCCCC | 48.64 | 25953088 | |
36 | Phosphorylation | ESGKNKHSSGQQNLN HHCCCCCCCCCCCHH | 37.46 | 30624053 | |
37 | Phosphorylation | SGKNKHSSGQQNLNT HCCCCCCCCCCCHHH | 40.10 | 25159151 | |
44 | Phosphorylation | SGQQNLNTITYETLK CCCCCHHHHHHHHHH | 20.19 | 23186163 | |
46 | Phosphorylation | QQNLNTITYETLKYI CCCHHHHHHHHHHHH | 17.17 | 28796482 | |
47 | Phosphorylation | QNLNTITYETLKYIS CCHHHHHHHHHHHHC | 11.76 | 28152594 | |
49 | Phosphorylation | LNTITYETLKYISKT HHHHHHHHHHHHCCC | 20.38 | 28796482 | |
51 | Acetylation | TITYETLKYISKTPC HHHHHHHHHHCCCCC | 48.21 | 19608861 | |
55 | Ubiquitination | ETLKYISKTPCRHQS HHHHHHCCCCCCCCC | 47.10 | - | |
56 | Phosphorylation | TLKYISKTPCRHQSP HHHHHCCCCCCCCCH | 22.34 | 25159151 | |
62 | Phosphorylation | KTPCRHQSPEIVREF CCCCCCCCHHHHHHH | 20.55 | 20068231 | |
74 | Ubiquitination | REFLTALKSHKLTKA HHHHHHHHHCCCCHH | 48.31 | - | |
101 (in isoform 2) | Ubiquitination | - | 11.39 | 21906983 | |
104 | Phosphorylation | IQLMVEESEERLTEE EEEEHHHHHHHCCHH | 31.11 | 28270605 | |
134 (in isoform 1) | Ubiquitination | - | 69.56 | 21906983 | |
134 | Ubiquitination | EPEAEQKKNTNSNVA CCHHHHHCCCCCCCC | 69.56 | 2190698 | |
142 | Sulfoxidation | NTNSNVAMDEEDPA- CCCCCCCCCCCCCC- | 6.08 | 21406390 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RPC9_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RPC9_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RPC9_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ZMIZ2_HUMAN | ZMIZ2 | physical | 25416956 | |
RPC5_HUMAN | POLR3E | physical | 26344197 | |
RPC6_HUMAN | POLR3F | physical | 26344197 | |
RPC10_HUMAN | POLR3K | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Immunoaffinity profiling of tyrosine phosphorylation in cancercells."; Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H.,Zha X.-M., Polakiewicz R.D., Comb M.J.; Nat. Biotechnol. 23:94-101(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-47, AND MASSSPECTROMETRY. |