UniProt ID | RPC10_HUMAN | |
---|---|---|
UniProt AC | Q9Y2Y1 | |
Protein Name | DNA-directed RNA polymerase III subunit RPC10 | |
Gene Name | POLR3K | |
Organism | Homo sapiens (Human). | |
Sequence Length | 108 | |
Subcellular Localization | Nucleus, nucleolus . | |
Protein Description | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway (By similarity).. | |
Protein Sequence | MLLFCPGCGNGLIVEEGQRCHRFSCNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
24 | Phosphorylation | GQRCHRFSCNTCPYV CCEEEEEECCCCCCH | 13.35 | - | |
27 | Phosphorylation | CHRFSCNTCPYVHNI EEEEECCCCCCHHHH | 21.13 | - | |
30 | Phosphorylation | FSCNTCPYVHNITRK EECCCCCCHHHHHHH | 19.25 | - | |
35 | Phosphorylation | CPYVHNITRKVTNRK CCCHHHHHHHHHCCC | 29.74 | - | |
71 | Ubiquitination | STAESCPKCEHPRAY CCHHHCCCCCCCHHE | 57.49 | 33845483 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RPC10_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RPC10_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RPC10_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RPAC1_HUMAN | POLR1C | physical | 26344197 | |
RPC4_HUMAN | POLR3D | physical | 26344197 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...