UniProt ID | RPC7_HUMAN | |
---|---|---|
UniProt AC | O15318 | |
Protein Name | DNA-directed RNA polymerase III subunit RPC7 | |
Gene Name | POLR3G | |
Organism | Homo sapiens (Human). | |
Sequence Length | 223 | |
Subcellular Localization | Nucleus . Cytoplasm . Excluded from nucleoli (PubMed:21898682). In zygotes and the 2-cell stage embryos, mainly in the cytoplasm. Starts to localize to the nucleus in the 8-16 cell stage embryo and early blastocysts (By similarity). | |
Protein Description | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. [PubMed: 20154270 May direct with other members of the RPC3/POLR3C-RPC6/POLR3F-RPC7/POLR3G subcomplex RNA Pol III binding to the TFIIIB-DNA complex via the interactions between TFIIIB and POLR3F. May be involved either in the recruitment and stabilization of the subcomplex within RNA polymerase III, or in stimulating catalytic functions of other subunits during initiation. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs), induce type I interferon and NF- Kappa-B through the RIG-I pathway] | |
Protein Sequence | MAGNKGRGRAAYTFNIEAVGFSKGEKLPDVVLKPPPLFPDTDYKPVPLKTGEGEEYMLALKQELRETMKRMPYFIETPEERQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTPLTNTEDVLKKMEELEKRGDGEKSDEENEEKEGSKEKSKEGDDDDDDDAAEQEEYDEEEQEEENDYINSYFEDGDDFGADSDDNMDEATY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Methylation | -MAGNKGRGRAAYTF -CCCCCCCCCEEEEE | 32.79 | 115383475 | |
9 | Methylation | AGNKGRGRAAYTFNI CCCCCCCCEEEEEEE | 18.06 | 115383483 | |
33 | Ubiquitination | KLPDVVLKPPPLFPD CCCCEECCCCCCCCC | 43.82 | 21906983 | |
44 | Ubiquitination | LFPDTDYKPVPLKTG CCCCCCCCCCCCCCC | 42.20 | 21906983 | |
56 | Phosphorylation | KTGEGEEYMLALKQE CCCCCHHHHHHHHHH | 7.98 | 27642862 | |
61 | Ubiquitination | EEYMLALKQELRETM HHHHHHHHHHHHHHH | 35.80 | 21906983 | |
67 | Phosphorylation | LKQELRETMKRMPYF HHHHHHHHHHHCCCC | 22.89 | 24719451 | |
73 | Phosphorylation | ETMKRMPYFIETPEE HHHHHCCCCCCCHHH | 14.08 | 24719451 | |
77 | Phosphorylation | RMPYFIETPEERQDI HCCCCCCCHHHHHHH | 31.05 | 24719451 | |
89 | Acetylation | QDIERYSKRYMKVYK HHHHHHHHHHHHHHH | 38.32 | 20167786 | |
118 | Acetylation | MPRNKCKKAGPKPKK CCHHHHHCCCCCCCC | 68.96 | 164371 | |
122 | Acetylation | KCKKAGPKPKKAKDA HHHCCCCCCCCCHHC | 69.43 | 164375 | |
131 | Acetylation | KKAKDAGKGTPLTNT CCCHHCCCCCCCCCH | 62.42 | 26051181 | |
133 | Phosphorylation | AKDAGKGTPLTNTED CHHCCCCCCCCCHHH | 20.72 | 25159151 | |
136 | Phosphorylation | AGKGTPLTNTEDVLK CCCCCCCCCHHHHHH | 41.10 | 29396449 | |
138 | Phosphorylation | KGTPLTNTEDVLKKM CCCCCCCHHHHHHHH | 28.47 | 29396449 | |
157 | Phosphorylation | KRGDGEKSDEENEEK HCCCCCCCHHHHHHH | 46.05 | 29255136 | |
167 | Phosphorylation | ENEEKEGSKEKSKEG HHHHHCCCHHHCCCC | 38.44 | 26074081 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RPC7_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RPC7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RPC7_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RPC8_HUMAN | POLR3H | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Global proteomic profiling of phosphopeptides using electron transferdissociation tandem mass spectrometry."; Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A.; Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-157, AND MASSSPECTROMETRY. | |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-133, AND MASSSPECTROMETRY. |