UniProt ID | RPAB3_HUMAN | |
---|---|---|
UniProt AC | P52434 | |
Protein Name | DNA-directed RNA polymerases I, II, and III subunit RPABC3 | |
Gene Name | POLR2H | |
Organism | Homo sapiens (Human). | |
Sequence Length | 150 | |
Subcellular Localization | Nucleus, nucleolus . | |
Protein Description | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively.. | |
Protein Sequence | MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAGILFEDI ------CCCCEEEEC | 17.46 | 22223895 | |
13 | Ubiquitination | FEDIFDVKDIDPEGK EEECCCCCCCCCCCC | 51.30 | 29967540 | |
13 | Sumoylation | FEDIFDVKDIDPEGK EEECCCCCCCCCCCC | 51.30 | - | |
20 | Ubiquitination | KDIDPEGKKFDRVSR CCCCCCCCCCCCEEE | 48.91 | 33845483 | |
20 | Acetylation | KDIDPEGKKFDRVSR CCCCCCCCCCCCEEE | 48.91 | 23749302 | |
20 | Ubiquitination | KDIDPEGKKFDRVSR CCCCCCCCCCCCEEE | 48.91 | - | |
20 | Acetylation | KDIDPEGKKFDRVSR CCCCCCCCCCCCEEE | 48.91 | - | |
21 | Ubiquitination | DIDPEGKKFDRVSRL CCCCCCCCCCCEEEE | 64.45 | 33845483 | |
21 | Ubiquitination | DIDPEGKKFDRVSRL CCCCCCCCCCCEEEE | 64.45 | - | |
47 (in isoform 5) | Phosphorylation | - | 3.58 | 27732954 | |
48 (in isoform 5) | Phosphorylation | - | 4.84 | 27732954 | |
49 (in isoform 5) | Phosphorylation | - | 18.12 | 27732954 | |
51 (in isoform 5) | Phosphorylation | - | 40.19 | 27732954 | |
53 (in isoform 5) | Phosphorylation | - | 31.44 | 27732954 | |
54 (in isoform 5) | Phosphorylation | - | 54.97 | 27732954 | |
59 | Ubiquitination | LGDKFRLVIASTLYE CCCCEEEEEEEEEEC | 2.75 | 21890473 | |
59 | Ubiquitination | LGDKFRLVIASTLYE CCCCEEEEEEEEEEC | 2.75 | 21963094 | |
65 | Phosphorylation | LVIASTLYEDGTLDD EEEEEEEECCCCCCC | 16.44 | - | |
75 | Phosphorylation | GTLDDGEYNPTDDRP CCCCCCCCCCCCCCC | 31.78 | 22817900 | |
78 | Phosphorylation | DDGEYNPTDDRPSRA CCCCCCCCCCCCCHH | 47.06 | - | |
82 | Ubiquitination | YNPTDDRPSRADQFE CCCCCCCCCHHHCCE | 34.85 | 21890473 | |
82 | Ubiquitination | YNPTDDRPSRADQFE CCCCCCCCCHHHCCE | 34.85 | 21890473 | |
83 | Ubiquitination | NPTDDRPSRADQFEY CCCCCCCCHHHCCEE | 40.78 | 21890473 | |
83 (in isoform 2) | Phosphorylation | - | 40.78 | 27732954 | |
83 | Ubiquitination | NPTDDRPSRADQFEY CCCCCCCCHHHCCEE | 40.78 | 21890473 | |
84 (in isoform 2) | Phosphorylation | - | 44.88 | 27732954 | |
85 (in isoform 2) | Phosphorylation | - | 21.21 | 27732954 | |
87 (in isoform 2) | Phosphorylation | - | 31.89 | 27732954 | |
89 (in isoform 2) | Phosphorylation | - | 31.42 | 27732954 | |
90 (in isoform 2) | Phosphorylation | - | 7.57 | 27732954 | |
90 | Phosphorylation | SRADQFEYVMYGKVY CHHHCCEEEEEEEEE | 7.57 | - | |
92 | Sulfoxidation | ADQFEYVMYGKVYRI HHCCEEEEEEEEEEE | 3.41 | 30846556 | |
95 | Ubiquitination | FEYVMYGKVYRIEGD CEEEEEEEEEEEECC | 20.71 | 21963094 | |
104 | Phosphorylation | YRIEGDETSTEAATR EEEECCCCCHHHHHH | 45.77 | 21712546 | |
105 | Phosphorylation | RIEGDETSTEAATRL EEECCCCCHHHHHHH | 23.39 | 23532336 | |
110 | Ubiquitination | ETSTEAATRLSAYVS CCCHHHHHHHHHEEE | 38.91 | 21890473 | |
110 | Ubiquitination | ETSTEAATRLSAYVS CCCHHHHHHHHHEEE | 38.91 | 21890473 | |
111 | Ubiquitination | TSTEAATRLSAYVSY CCHHHHHHHHHEEEH | 23.17 | 21890473 | |
111 | Ubiquitination | TSTEAATRLSAYVSY CCHHHHHHHHHEEEH | 23.17 | 21890473 | |
118 | Ubiquitination | RLSAYVSYGGLLMRL HHHHEEEHHCEEEEE | 12.74 | 21890473 | |
118 | Ubiquitination | RLSAYVSYGGLLMRL HHHHEEEHHCEEEEE | 12.74 | 21890473 | |
118 | Phosphorylation | RLSAYVSYGGLLMRL HHHHEEEHHCEEEEE | 12.74 | - | |
119 | Ubiquitination | LSAYVSYGGLLMRLQ HHHEEEHHCEEEEEE | 16.86 | 21890473 | |
119 | Ubiquitination | LSAYVSYGGLLMRLQ HHHEEEHHCEEEEEE | 16.86 | 21890473 | |
142 | Phosphorylation | FEVDSRVYLLMKKLA CCCHHHHHHHHHHHC | 7.94 | 22817900 | |
146 | Ubiquitination | SRVYLLMKKLAF--- HHHHHHHHHHCC--- | 44.60 | 21906983 | |
147 | Ubiquitination | RVYLLMKKLAF---- HHHHHHHHHCC---- | 30.96 | 21906983 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RPAB3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RPAB3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RPB1_HUMAN | POLR2A | physical | 9201987 | |
RPB2_HUMAN | POLR2B | physical | 9201987 | |
RPB3_HUMAN | POLR2C | physical | 9201987 | |
RPAB1_HUMAN | POLR2E | physical | 9201987 | |
RPB7_HUMAN | POLR2G | physical | 9201987 | |
RPAB3_HUMAN | POLR2H | physical | 9201987 | |
BARD1_HUMAN | BARD1 | physical | 17283126 | |
RPB1_HUMAN | POLR2A | physical | 17283126 | |
RPC1_HUMAN | POLR3A | physical | 17283126 | |
MCAF1_MOUSE | Atf7ip | physical | 10777215 | |
RPC8_HUMAN | POLR3H | physical | 22939629 | |
RPC4_HUMAN | POLR3D | physical | 22939629 | |
RPAC1_HUMAN | POLR1C | physical | 22939629 | |
RPC2_HUMAN | POLR3B | physical | 22939629 | |
RPC1_HUMAN | POLR3A | physical | 22939629 | |
RPAB1_HUMAN | POLR2E | physical | 22863883 | |
SART3_HUMAN | SART3 | physical | 22863883 | |
ESR1_HUMAN | ESR1 | physical | 16957778 | |
SRC_HUMAN | SRC | physical | 16957778 | |
PSB9_HUMAN | PSMB9 | physical | 16957778 | |
ELOA1_HUMAN | TCEB3 | physical | 16957778 | |
RPC9_HUMAN | CRCP | physical | 26344197 | |
RPA1_HUMAN | POLR1A | physical | 26344197 | |
RPB2_HUMAN | POLR2B | physical | 26344197 | |
RPAB1_HUMAN | POLR2E | physical | 26344197 | |
RPB9_HUMAN | POLR2I | physical | 26344197 | |
RPAB5_HUMAN | POLR2L | physical | 26344197 | |
SPT5H_HUMAN | SUPT5H | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. |