RPAB5_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RPAB5_HUMAN
• UniProt AC: P62875
• Protein Name: DNA-directed RNA polymerases I, II, and III subunit RPABC5
• Gene Name: POLR2L
• Organism: Homo sapiens (Human).
• Sequence Length: 67
• Subcellular Localization: Nucleus .
• Protein Description: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2L/RBP10 is part of the core element with the central large cleft (By similarity)..
• Protein Sequence: MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
12	Ubiquitination	VRCFTCGKIVGNKWE EEECCCCCCCCCHHH	36.04	23000965
17	Ubiquitination	CGKIVGNKWEAYLGL CCCCCCCHHHHHHHH	40.25	23000965
41	Ubiquitination	ALDALGLKRYCCRRM HHHHHCCHHHHHHHH	39.25	22817900
58	Ubiquitination	AHVDLIEKLLNYAPL HHHHHHHHHHHCCCC	51.81	33845483
62	Phosphorylation	LIEKLLNYAPLEK-- HHHHHHHCCCCCC--	15.01	29978859
67	Ubiquitination	LNYAPLEK------- HHCCCCCC-------	73.63	23000965

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RPAB5_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RPAB5_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RPAB5_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CC85B_HUMAN	CCDC85B	physical	16189514
RPB1_HUMAN	POLR2A	physical	9201987
RPB2_HUMAN	POLR2B	physical	9201987
RPB3_HUMAN	POLR2C	physical	9201987
RPAB1_HUMAN	POLR2E	physical	9201987
RPB7_HUMAN	POLR2G	physical	9201987
RPAB3_HUMAN	POLR2H	physical	9201987
SNX7_HUMAN	SNX7	physical	21988832
ESR1_HUMAN	ESR1	physical	16957778
SRC_HUMAN	SRC	physical	16957778
PSB9_HUMAN	PSMB9	physical	16957778
ELOA1_HUMAN	TCEB3	physical	16957778
REL_HUMAN	REL	physical	25416956
ASPP2_HUMAN	TP53BP2	physical	25416956
ZBT14_HUMAN	ZBTB14	physical	25416956
COIL_HUMAN	COIL	physical	25416956
SPAG5_HUMAN	SPAG5	physical	25416956
RPAP1_HUMAN	RPAP1	physical	25416956
BANP_HUMAN	BANP	physical	25416956
THAP1_HUMAN	THAP1	physical	25416956
LMBL3_HUMAN	L3MBTL3	physical	25416956
RPA1_HUMAN	POLR1A	physical	26344197
RPB2_HUMAN	POLR2B	physical	26344197
RPB9_HUMAN	POLR2I	physical	26344197
COIL_HUMAN	COIL	physical	21516116

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.